Details for Chinese cabbage Locus Brara.A02845

Position : A01 ( 5`- 24254849 .. 24257470 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02845

Protein [Map View]
MMSIVSSHHHCQPSFTHEQRCGIGTLSKVSYSGPCFSGRLAFSHSLCLKSSCKGETGRRRVSRICSVVDDGMNPDSSDDE
EKESLDDKSKREADDMNRANLERMVGSDDSAFNGLDLATLIRQKYGRSYDVQLIKKEFMGRNLLAMNVMWKYREQRSFPL
TEEEYILRLDDVANMLKCWGAVSHIRNSLAKSKERPRIGKAVSIFIDMDSTGGRANEWIYK*

DNA
ATGATGAGCATTGTTTCAAGTCACCATCATTGTCAACCGTCGTTTACACACGAACAACGATGCGGTATAGGAACGCTTTC
TAAAGTTTCTTACTCCGGTCCCTGTTTCTCTGGAAGATTGGCTTTCTCTCATAGCCTCTGCTTGAAGAGTTCTTGTAAGG
GGGAAACTGGTAGGAGAAGGGTTTCAAGAATTTGCAGTGTTGTGGATGATGGGATGAATCCAGATAGTTCAGATGACGAG
GAAAAGGAATCACTCGATGATAAATCTAAAAGGGAAGCGGATGATATGAATCGGGCAAATCTTGAAAGAATGGTTGGGTC
GGATGATTCTGCGTTTAATGGCTTAGATCTTGCAACCCTTATCAGGCAGAAGTATGGAAGATCTTATGATGTTCAGCTCA
TCAAGAAGGAGTTCATGGGGAGGAATCTTCTTGCAATGAATGTCATGTGGAAGTACAGAGAACAGAGGTCTTTTCCTCTA
ACCGAAGAAGAATATATACTGAGACTTGACGATGTAGCCAACATGTTGAAATGCTGGGGAGCGGTCTCACATATCCGTAA
TAGCCTAGCAAAGTCCAAAGAGCGACCCAGGATAGGGAAGGCTGTGAGCATTTTCATAGACATGGATTCAACAGGGGGAC
GAGCAAACGAATGGATTTACAAGTAG