Details for Chinese cabbage Locus Brara.A02844

Position : A01 ( 5`- 24250084 .. 24253145 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02844

Protein [Map View]
MAMEKDNSDHASNVAVTAEQATKINDADARSPENRQTGVVPESGSGSSEKGEEGAETAAAAVDDDESGSNSVGELLPPRS
SSSARVPFTNLSQIDSDLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYEEDEFDDPEDDEEDEYETDDDPQEDAP
DVNANGDDQEDGGRNAETEEAGYSDDEAFARAIQEAEAREMADRLSALTGLANRVEVLEDDDHTSEDAWDEMDPDELSYE
ELLALGDIVGTESRGLSADIIASLPSKRYKDGENQNGTNESCVICRLDYEDDDDLILLPCKHSYHSECINNWLKINKICP
VCSAEVSTSSAGQS*

DNA
ATGGCCATGGAGAAGGACAACAGCGACCACGCTAGCAACGTCGCCGTCACCGCCGAGCAAGCGACCAAGATCAACGACGC
TGATGCACGGTCGCCGGAGAATCGTCAGACCGGCGTCGTACCGGAATCCGGAAGCGGAAGCAGCGAGAAAGGAGAGGAAG
GTGCGGAAACGGCGGCGGCGGCTGTGGATGATGATGAGAGCGGATCGAATTCGGTTGGCGAGCTGCTACCTCCCCGATCT
TCTTCCTCCGCTAGAGTTCCGTTCACTAATCTGAGCCAAATCGATTCGGATCTTGCTCTCGCTCGCACGCTACAAGAACA
GGAGCGGGCGTATATGATGCTGACGATGAACAGTGAAATCAGTGACTATGGGAGCTGGGAAACTGGAAGCTATGTCTACG
AGGAGGATGAGTTTGATGACCCCGAGGATGACGAGGAAGACGAATATGAAACTGATGATGATCCTCAGGAAGATGCGCCC
GATGTGAATGCGAATGGAGACGATCAAGAAGATGGCGGCAGAAACGCTGAGACCGAGGAAGCTGGTTATTCAGATGATGA
AGCTTTTGCTAGAGCTATTCAGGAAGCTGAGGCAAGGGAAATGGCTGATAGGTTGTCTGCCTTGACTGGGTTAGCTAATC
GGGTTGAAGTTCTAGAGGATGATGATCATACTTCTGAGGATGCCTGGGATGAGATGGATCCTGATGAGCTTTCATATGAG
GAGTTGCTTGCGCTTGGAGACATCGTGGGAACCGAGAGTAGAGGGTTGTCTGCTGATATAATTGCATCATTGCCTTCAAA
AAGATATAAAGATGGAGAAAATCAGAACGGAACCAATGAGTCGTGTGTTATATGTCGTCTAGACTATGAGGACGACGATG
ACTTGATACTGCTTCCATGCAAACATTCTTACCACTCGGAGTGCATTAATAACTGGTTGAAGATAAACAAGATTTGCCCT
GTATGCAGCGCAGAAGTTTCAACCTCCTCAGCTGGACAAAGCTAA