Details for Chinese cabbage Locus Brara.A02841

Position : A01 ( 5`- 24178761 .. 24181003 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02841

Protein [Map View]
MSSGGNSTLSTAAAADKLFFCYQCNRTVTISISSADDPFCPRCSGGFLEEYEEPNPNPSPNLNPLGFLPMADPFSTILPL
LFGSSSAPPSSNPSLFGPRSTENQPQGGGAFDPVSFLQNHLQHLQSSGTHVQFVIEDHPSDPFSRIPGNMGDYFFGPGLE
QLIQQLAENDPNRYGTPPASKSAIDALPTVKVTLDMLNSEMNQCAVCMDEFEDGGDVKQMPCKHVFHQGCLMPWLELHNS
CPVCRYELPTDDPDYESRGQRGGQMMSGGGQGSVEGQQTARRFSIQLPLRFRTQDGSGSGRGSGSGSGAGGGGGGGSNLE
TRQEDLD*

DNA
ATGTCTTCCGGCGGAAACTCTACTCTCTCCACCGCCGCGGCGGCTGACAAGCTGTTCTTCTGTTACCAGTGCAATCGCAC
AGTCACCATCTCAATCTCCTCCGCCGACGATCCTTTCTGCCCCCGTTGCTCCGGTGGGTTTCTAGAAGAATACGAAGAAC
CAAACCCTAACCCATCCCCAAATCTCAACCCTCTCGGTTTCCTCCCGATGGCTGATCCTTTCTCCACCATCCTCCCGCTC
TTATTCGGCTCCTCCTCCGCTCCTCCTTCCTCGAACCCGAGCCTCTTCGGCCCACGCTCTACCGAGAATCAGCCTCAAGG
CGGAGGAGCGTTTGATCCGGTGTCGTTTCTCCAGAACCATCTCCAGCATCTGCAGTCCAGCGGCACTCACGTCCAGTTCG
TGATCGAGGATCATCCCTCGGATCCGTTTAGCCGGATACCTGGAAACATGGGGGACTACTTCTTTGGCCCTGGCCTTGAG
CAGCTGATTCAGCAGCTCGCGGAGAATGACCCTAACCGATACGGAACTCCTCCTGCCTCCAAATCCGCGATCGACGCGCT
GCCGACTGTTAAGGTGACGTTGGATATGTTGAACTCTGAGATGAACCAGTGCGCCGTTTGTATGGATGAGTTTGAGGATG
GCGGCGATGTGAAGCAGATGCCTTGCAAGCATGTGTTTCATCAGGGTTGTTTGATGCCGTGGCTTGAGTTGCATAACTCT
TGTCCGGTTTGTCGGTATGAGTTGCCTACTGATGATCCTGATTATGAGAGCAGGGGGCAAAGGGGAGGTCAGATGATGAG
TGGGGGTGGGCAGGGGTCGGTTGAGGGTCAGCAGACGGCAAGGAGGTTTAGTATACAGCTGCCTTTGCGGTTCAGGACTC
AGGATGGCTCTGGTTCTGGACGTGGTTCAGGGTCTGGAAGTGGTGCTGGTGGTGGTGGTGGAGGTGGGTCTAATCTTGAG
ACCAGACAGGAAGATTTGGATTGA