Details for Chinese cabbage Locus Brara.A02839

Position : A01 ( 5`- 24172598 .. 24174780 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02839

Protein [Map View]
MGSSPNLSTVLELARPFLRGELENIDPNLPSLIAVLKSVGAGECWHKHGSFLDHLIDIYKILKLWKAPDPVCLCGLFHSA
YSNSYVNLAIFHPSTGRDVVRGHVGENAEALIHLFCVVPRQTLIHDDLLFKYSDQELVEHLDRSEVSLRKAKEGGGFDGE
EEWRRKVNSLVPEDGVVVKHIKTGEEIVVSRRVVGVFLLMTMADFSDQLFGFQDELFCNDDGRLEFRGNNVAALWPGSGK
PGLWMNSNSRMGAVYSLIVREEEILMEQRKRDCGGSGFVVRKERDEDIELVVPPVFSFCTKVLDAKEQIEARDMYWEAVT
SDASKDGYLERAEERLLGCIEKNPFVGEPHVLLSQVYLGKKRFAEAEREAERGLLLLLQWGSPWDKRMSWEGWVAWVRVL
LMKSQDQSWPDASWGILNLGLVR*

DNA
ATGGGCTCATCACCAAACCTCTCCACCGTTCTCGAACTAGCCCGACCTTTCCTCCGAGGAGAGCTAGAGAACATCGACCC
CAACCTCCCCTCCCTAATCGCCGTCCTCAAAAGCGTCGGCGCAGGCGAGTGCTGGCACAAACACGGCAGCTTCCTAGACC
ACTTGATCGACATCTACAAGATCCTCAAGCTCTGGAAAGCCCCCGACCCCGTCTGCCTCTGCGGCCTCTTCCACTCCGCT
TACTCCAACTCCTACGTCAACCTAGCCATCTTCCACCCCTCCACCGGCCGCGACGTCGTCCGTGGACACGTCGGCGAGAA
CGCCGAGGCCCTGATCCATCTCTTCTGCGTCGTCCCGAGACAGACTCTGATCCATGATGACCTCCTCTTCAAGTACTCGG
ACCAAGAGCTCGTGGAGCATCTCGATCGCTCTGAGGTGTCCTTGAGGAAGGCCAAGGAGGGAGGAGGGTTCGATGGAGAG
GAAGAGTGGAGGAGGAAGGTTAACAGTTTGGTGCCTGAGGACGGCGTCGTTGTGAAGCATATCAAGACTGGTGAAGAGAT
TGTTGTTTCGAGGAGGGTTGTTGGTGTGTTCTTGTTGATGACGATGGCGGATTTTAGTGATCAGCTTTTCGGGTTTCAGG
ATGAGTTGTTTTGTAATGATGATGGGAGGTTGGAGTTTAGAGGGAATAATGTGGCGGCGTTGTGGCCTGGAAGTGGGAAG
CCTGGGCTGTGGATGAACTCTAACTCGAGGATGGGTGCGGTTTATAGTTTGATTGTGAGGGAAGAAGAGATTCTGATGGA
GCAGAGGAAGAGAGATTGTGGTGGTTCTGGGTTTGTGGTGAGGAAGGAGAGAGATGAAGATATTGAGCTCGTTGTGCCTC
CTGTTTTCAGCTTCTGCACCAAGGTACTGGATGCAAAAGAGCAGATAGAAGCAAGGGACATGTACTGGGAAGCTGTGACC
AGCGACGCAAGCAAAGACGGGTACTTGGAGAGAGCAGAGGAGAGATTGTTGGGGTGTATTGAGAAGAACCCGTTTGTGGG
AGAGCCACATGTGCTGTTGAGTCAAGTGTATCTGGGAAAGAAGAGATTCGCAGAGGCAGAGAGAGAAGCAGAGAGAGGGC
TACTTCTGCTGTTGCAATGGGGAAGTCCATGGGACAAGAGGATGTCATGGGAAGGTTGGGTTGCTTGGGTTAGAGTTCTT
CTCATGAAGTCACAGGATCAATCTTGGCCAGATGCTTCTTGGGGAATCTTGAACTTGGGTCTTGTGCGCTAA