Details for Chinese cabbage Locus Brara.A02836

Position : A01 ( 5`- 24152020 .. 24155458 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02836

Protein [Map View]
MLVDDIGDVTITNDGATILRMLEVEHPAAKVLVELAELQDREVGDGTTSVVIVAAELLKRANDLVRNKIHPTSIISGYRL
AMREACKYIEEKLVTKVEKLGKVPLINCAKTSMSSKLISGDSDFFANLVVDAVLSVKMTNQRGEIKYPIKGINILKAHGQ
SARDSYLLNGYALNTGRAAQGMPLRVSPAKIACLDFNLQKTKMQLGVQVVVNDPRELEKIRQREADMTKERIEKLLKAGA
NVILTTKGIDDMALKYFVEAEAIAVRRVRKEDMRHVAKATGATLVTTFADMEGEETFDPAHLGTAEEVVEERIADDDVVL
IKGTKTSSAVSLILRGANDYMLDEMERALHDALCIVKRTLESNTVVAGGGAVESALSVYLEHLATTLGSREQLAIAEFAD
ALLIIPKVLAVNAAKDATELVAKLRAYHHTAQTKADKKHYSRIDDMIKLVKEDGQGDE*

DNA
ATGTTGGTGGATGATATTGGTGATGTGACCATTACAAATGACGGTGCTACTATTCTTAGGATGCTGGAGGTCGAACACCC
TGCTGCTAAGGTTCTCGTCGAGTTAGCTGAACTCCAGGATAGAGAAGTTGGTGATGGGACTACATCTGTTGTTATTGTTG
CTGCTGAGTTGCTTAAGAGGGCTAATGATTTGGTGAGGAACAAAATACATCCCACATCTATTATCAGTGGATACCGGCTG
GCAATGAGAGAGGCTTGCAAATACATTGAAGAGAAGTTGGTTACTAAGGTTGAAAAGCTTGGGAAAGTTCCATTGATAAA
CTGTGCTAAAACCAGCATGTCTTCCAAACTGATATCTGGTGACAGCGACTTCTTTGCCAATTTGGTTGTCGATGCCGTTC
TGTCAGTAAAAATGACAAATCAGCGGGGGGAGATTAAATACCCTATCAAGGGGATTAATATTCTGAAAGCTCATGGACAA
AGTGCCAGAGACAGCTACTTGTTGAATGGGTATGCACTCAACACTGGACGTGCTGCCCAGGGGATGCCACTACGAGTGTC
TCCGGCGAAGATTGCTTGCCTCGACTTCAATCTTCAGAAGACAAAGATGCAGCTTGGTGTCCAGGTTGTTGTTAACGATC
CACGAGAATTGGAAAAAATCCGTCAAAGAGAAGCTGACATGACAAAAGAGCGGATAGAGAAACTTCTTAAAGCTGGGGCC
AATGTTATTCTGACCACAAAGGGTATTGACGACATGGCACTTAAATACTTTGTAGAGGCAGAAGCTATTGCTGTTAGGCG
TGTCCGCAAAGAAGACATGCGCCATGTTGCTAAGGCAACAGGAGCAACCCTCGTCACCACTTTTGCTGACATGGAGGGCG
AAGAAACATTTGATCCGGCACACCTTGGAACTGCAGAGGAAGTTGTGGAAGAGAGAATCGCAGATGATGATGTTGTATTG
ATAAAGGGAACCAAAACGAGCAGTGCGGTCTCCTTGATCTTGAGAGGTGCAAATGACTACATGCTTGATGAGATGGAGAG
AGCACTACACGATGCTTTATGTATTGTCAAGAGGACCCTCGAGTCCAACACGGTGGTTGCGGGTGGAGGTGCAGTTGAGT
CAGCGTTGTCTGTGTATCTGGAGCACCTTGCTACAACCTTGGGATCTCGCGAACAATTGGCAATTGCTGAATTTGCAGAT
GCGCTGTTGATTATCCCAAAGGTGCTTGCAGTAAACGCGGCTAAGGACGCAACCGAGTTGGTAGCTAAACTAAGAGCTTA
CCACCACACCGCACAAACCAAGGCTGATAAGAAGCACTATTCAAGAATCGACGACATGATCAAACTGGTGAAGGAAGATG
GCCAAGGCGATGAGTAA