Details for Chinese cabbage Locus Brara.A02835

Position : A01 ( 5`- 24150089 .. 24151011 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02835

Protein [Map View]
MAAVNGYQGNTPAETTPAATGSKQPAPPSKTVDSQSVLKRLQSELMGLMMGGDPGVSAFPEEDNIFCWKGTITGSNDTVF
EGTEYRLSLAFSNDYPFKPPKVKFETCCFHPNVDLYGNICLDILQV

DNA
ATGGCGGCGGTAAATGGATACCAAGGAAATACTCCGGCGGAGACAACCCCGGCAGCCACCGGATCGAAACAACCTGCTCC
TCCGTCTAAAACCGTCGATAGCCAATCCGTTCTCAAAAGGCTGCAATCTGAACTTATGGGCTTAATGATGGGAGGTGATC
CGGGGGTATCTGCTTTCCCAGAGGAAGACAACATATTCTGCTGGAAAGGAACAATCACAGGAAGCAATGATACTGTTTTT
GAAGGAACAGAGTACAGACTCTCACTCGCTTTCTCCAACGATTATCCTTTCAAACCTCCCAAAGTTAAGTTCGAGACTTG
CTGCTTCCATCCCAATGTGGATCTCTATGGCAATATTTGCTTGGACATTCTTCAGGTA