Details for Chinese cabbage Locus Brara.A02833

Position : A01 ( 5`- 24131665 .. 24133349 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02833

Protein [Map View]
MLTWESQVRLASNTALTKKLAFITFFIIGLCPAIMVMSQEHKVVPGSDADSLLRFKDTLANASVISSWDPSTAPCKRKSS
NWFGVLCFAGHVWGLQLEGMGLTGKLDLEPLTPIKDLRTLSFMNNNFDGAMPSVKKLVSLKSLYLSNNRFTGEIPADAFD
GMHHLKKLLLANNAFRGNVPSSLASLPLLLEVRLNGNQFQGAIPDFKQKDLKLASFENNDLEGPIPESLRNMDPGSFAGN
KDLCDPPLSSCSGDSWFFLDPPSTSTEKKSKSNSFYTIAIVLIVIGVILVIISFVVCVFHTRKQKCLSAYPSAGQDRTYK
YSYDQPADTERAAESVTSYTTKRVTVPDQDKLLFLQEDIQRFDLQDLLRASAEVLGSGCFGASYKAGISNGKTLVVKRYK
HMNNVGRDEFHEHIRRLGKLSHPNLLPLVAYYYRREEKLLIAEFMPNRSLASHLH

DNA
ATGCTAACTTGGGAGAGCCAGGTTAGGCTTGCAAGCAACACCGCCTTGACGAAGAAACTAGCCTTCATCACATTCTTCAT
CATTGGGTTATGTCCAGCCATAATGGTCATGTCTCAGGAGCACAAGGTTGTGCCAGGCTCAGACGCAGATTCCCTCTTGA
GATTCAAAGACACTTTAGCGAATGCTTCTGTCATTAGCAGTTGGGATCCTTCAACCGCGCCTTGTAAGCGAAAGTCATCA
AACTGGTTCGGTGTTCTCTGCTTTGCCGGACATGTTTGGGGTCTACAACTTGAAGGAATGGGTTTAACCGGGAAGCTAGA
CCTTGAACCATTGACTCCTATCAAGGACCTAAGAACCTTAAGCTTCATGAACAACAATTTCGACGGTGCAATGCCATCTG
TCAAGAAACTCGTCTCGTTGAAGTCATTGTACTTGTCTAACAACAGGTTTACAGGGGAGATACCCGCGGACGCGTTTGAT
GGTATGCATCATTTGAAAAAGCTTTTGCTGGCGAACAACGCCTTTCGCGGGAACGTCCCTTCTTCTTTAGCTTCTTTGCC
ATTGCTTTTAGAGGTGAGGCTGAATGGGAACCAGTTCCAAGGGGCGATACCTGATTTTAAACAGAAAGATCTTAAGTTAG
CTAGCTTCGAGAACAATGACCTCGAGGGACCTATACCCGAAAGCCTACGTAACATGGATCCTGGCTCTTTTGCAGGGAAC
AAGGACTTGTGTGATCCTCCACTAAGCTCATGCTCAGGGGATTCATGGTTTTTTCTGGATCCTCCTTCTACTTCCACGGA
GAAGAAGAGCAAGAGCAACTCTTTCTACACAATTGCAATCGTTTTGATTGTCATTGGTGTAATACTAGTGATCATCTCCT
TTGTGGTTTGTGTCTTTCACACCAGAAAACAGAAGTGCTTGTCGGCTTATCCATCCGCGGGGCAAGACAGGACATATAAA
TACAGTTATGATCAACCCGCCGACACGGAGAGAGCCGCGGAGTCTGTTACTAGCTACACTACTAAGAGAGTAACAGTACC
GGACCAGGACAAGCTCTTGTTTCTGCAAGAAGACATTCAGAGATTCGACCTTCAAGATCTTCTAAGAGCTTCTGCTGAAG
TACTTGGGAGTGGATGCTTTGGTGCTTCTTATAAAGCCGGGATAAGTAACGGCAAGACGCTGGTCGTGAAGAGGTATAAA
CATATGAACAACGTGGGAAGAGATGAGTTTCATGAGCATATAAGAAGGTTAGGGAAGCTGAGTCATCCGAATCTGTTACC
TCTTGTGGCTTACTATTACCGTAGAGAAGAGAAGCTTTTGATCGCTGAGTTCATGCCTAACCGTAGCTTGGCAAGCCATC
TTCAC