Details for Chinese cabbage Locus Brara.A02831

Position : A01 ( 5`- 24107347 .. 24109851 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02831

Protein [Map View]
MTDIDIGTAAERNDDGGGRREPLINREKKFKRSVSNVHDELHSFRKYLRWMCVDQSSPWTAVLSWSMFVVFTLVVPAMSH
FMLACANCDSHHSRPYDSGVQLSLSSFAALSFLCLSRFVSKFGLRRFLFFDKLWDESSTVRRGYTNQLNRSLKILSYFVA
PCFLAMSSYKIWWYASGASQIPFLGNVILSDTVACLMELCSWLYRTTVIFLVCVLFRLICHLQILRLQDFAQVFQMDSDV
GSILSEHLRIRRHLRIISHRYRIFILSSLILVTGSQFYSLLITTKSHAGLNVNSAGELALCSMTLVTALLILLRSASKIT
HKAQAVTCLAAKWHVCATIESFETVDGGTPRLVDRASGHGFYSTDVEIGDTDDSEDYGEEEDDFDNNDLIPAYAYSTISF
QKRQALVHYFENNKAGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS*

DNA
ATGACGGACATCGACATCGGAACCGCAGCAGAGAGAAACGACGACGGAGGAGGAAGACGAGAGCCGTTGATTAACCGTGA
AAAGAAGTTCAAGCGTTCTGTCTCGAACGTGCACGACGAACTCCATAGTTTCAGGAAATATCTGAGATGGATGTGCGTGG
ACCAGTCGAGCCCTTGGACAGCGGTTCTCTCTTGGTCCATGTTCGTCGTTTTCACGCTCGTGGTTCCGGCGATGTCTCAC
TTCATGCTCGCTTGCGCCAACTGCGATAGCCATCACTCGAGGCCGTACGATTCTGGGGTTCAGCTTTCTCTCAGCAGCTT
TGCTGCCCTTTCTTTTCTTTGTCTCTCGAGATTTGTTAGCAAGTTTGGTCTCCGACGGTTCCTCTTCTTCGATAAGCTTT
GGGATGAGAGCTCCACTGTTCGCCGAGGCTACACCAATCAGCTCAACAGATCACTTAAGATTCTCTCCTACTTTGTCGCT
CCTTGTTTCTTAGCCATGAGCTCATACAAGATATGGTGGTACGCTTCAGGAGCATCTCAGATTCCTTTCCTAGGTAACGT
CATCTTGAGTGATACAGTCGCTTGTCTGATGGAACTCTGCTCGTGGCTCTACCGGACTACAGTGATCTTCCTTGTTTGTG
TCCTCTTCCGTCTCATCTGCCATCTCCAGATCCTCAGGCTTCAAGACTTTGCTCAAGTCTTTCAAATGGATTCAGATGTT
GGTTCCATCTTGTCTGAACATCTCCGCATCAGACGTCACCTGAGAATCATCAGCCACCGTTACCGAATCTTCATATTGTC
GTCCTTGATTCTTGTCACTGGAAGTCAGTTTTACTCGCTGCTTATTACCACCAAGTCCCATGCTGGATTAAATGTAAACA
GTGCTGGAGAACTCGCCCTATGTTCAATGACACTGGTCACAGCGCTGCTCATTCTACTACGAAGTGCCTCAAAGATCACA
CACAAGGCTCAGGCGGTGACATGCCTTGCTGCAAAGTGGCATGTGTGCGCGACAATAGAATCATTTGAGACGGTGGATGG
AGGGACTCCAAGGTTAGTTGATAGAGCAAGCGGACACGGATTCTATTCAACAGATGTGGAAATTGGAGACACAGACGATA
GTGAAGATTATGGAGAGGAAGAAGATGATTTTGATAACAATGATCTCATTCCTGCTTATGCTTATAGCACCATATCATTT
CAAAAACGACAAGCTCTAGTGCATTACTTTGAGAACAACAAAGCAGGAATCACAGTGTTTGGGTTTACACTTGATAGAAG
TACTCTCCATACAATATTTGGGATCGAAATGTCGCTTGTTCTCTGGCTTTTGGGTAAGACCATTGGGATCTCTTGA