Details for Chinese cabbage Locus Brara.A02829

Position : A01 ( 5`- 24092527 .. 24096048 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02829

Protein [Map View]
YPNGLPHLPQKPRTRRLVVRAASPSSQPEGKSPLMVVLDVPRSIWRQTLKPLSDFGFGKRSVWEGGVGLFLVSGATLLAL
SWAWLRGFQMRAKFRKYQTVFELSQASGICTGTPVRIRGVTVGSVIRVNPSLKNIEAVVEIEDDKIIIPRNSLVEVNQSG
LLMETMIDITPKDPIPEPSVGPLHQECGKEGLIVCDREKIKGEQGVSLDELVGIFTRMGRDVEEIGVANAFSLAERVVSV
IEDAKPKVHSSILTPENTELIQKSIYTLVYTLKNVESISSDILGFTGDEATRKNLKLLIKSLSRLL*

DNA
TATCCCAATGGGCTTCCTCATCTCCCACAGAAACCTAGAACTAGGCGTTTAGTTGTCAGAGCTGCATCCCCTTCCAGTCA
ACCAGAAGGGAAGAGCCCTCTCATGGTTGTTTTGGATGTGCCGAGGAGTATATGGAGACAGACTTTGAAACCTCTGAGTG
ATTTTGGGTTTGGTAAGAGAAGTGTTTGGGAAGGTGGGGTTGGTTTGTTTCTCGTTTCCGGAGCTACTCTTCTTGCTCTT
AGCTGGGCTTGGTTAAGAGGGTTTCAAATGCGTGCCAAGTTCAGGAAGTATCAGACCGTGTTTGAGCTTAGTCAAGCCTC
AGGCATTTGCACGGGAACGCCGGTTAGGATCCGTGGTGTGACCGTTGGTTCGGTTATCCGGGTTAATCCGTCCTTGAAGA
ACATTGAAGCTGTTGTTGAGATTGAAGATGATAAGATTATCATCCCTAGGAACTCGCTGGTTGAGGTGAATCAGTCTGGT
CTTCTTATGGAGACTATGATCGACATTACGCCGAAGGATCCCATACCGGAACCTTCGGTAGGGCCTCTGCATCAAGAGTG
TGGCAAAGAAGGTCTGATTGTTTGTGATAGGGAGAAGATAAAGGGAGAGCAAGGAGTGAGTTTAGATGAGCTAGTTGGGA
TATTCACTCGTATGGGGCGCGATGTGGAGGAGATTGGTGTTGCCAATGCGTTTTCTCTTGCTGAGAGAGTTGTGTCGGTT
ATTGAAGATGCAAAGCCAAAGGTTCATTCGTCGATTTTGACACCTGAGAATACAGAACTAATACAGAAGTCAATCTACAC
TCTGGTTTACACTTTGAAGAACGTCGAGAGCATAAGCTCAGATATTCTAGGATTCACAGGCGATGAAGCCACCAGAAAGA
ACCTTAAACTACTCATCAAATCACTCAGTAGACTATTATAA