Details for Chinese cabbage Locus Brara.A02821

Position : A01 ( 5`- 24011162 .. 24011977 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02821

Protein [Map View]
MENSALSNCVRRTIFSTQQRTIQEGLEESSWTMYFETQDRTCQYDDSSMISDAASPMAYVEEDTASSPSKRTKGYSEMED
NTTEEKSMSNTKTEEKGLNKKGIINEDYCAELKKRGLCLVPLSMLSNYIG*

DNA
ATGGAAAACTCAGCACTGAGCAACTGCGTGAGGCGTACGATATTCTCTACTCAACAGAGAACAATACAAGAGGGTCTAGA
AGAGAGTAGTTGGACAATGTACTTTGAAACCCAAGATCGTACATGCCAATATGATGATTCTTCCATGATCTCAGACGCTG
CGTCCCCTATGGCCTATGTCGAAGAAGACACGGCTTCATCTCCTTCCAAAAGAACCAAGGGTTACAGTGAAATGGAAGAC
AATACCACAGAAGAAAAAAGCATGAGCAATACTAAAACTGAGGAGAAGGGATTGAATAAGAAAGGGATAATAAATGAAGA
TTATTGCGCAGAATTGAAGAAGCGAGGACTTTGCTTAGTTCCTTTGTCCATGTTGTCCAACTATATTGGTTGA