Details for Chinese cabbage Locus Brara.A02820

Position : A01 ( 5`- 24009487 .. 24010362 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02820

Protein [Map View]
MMLRGLTLVCLLMIVNKAYAREFMVGGAKGWTVPSGSQVYSQWAEESRFQVGDSLLFVYQPNQDSVFQVTRDAYDSCNTD
APTAKFADGKTSFALTHSGPYYFISGNKNNCNKNEKLVVIVMADRNGKTTSSSSPPSQAPAPSGEAAPSPPITSNLEPPA
TTPTRETPNNAASSFSSFVSALLGAALASTLFLH*

DNA
ATGATGCTTCGTGGGTTAACTCTCGTGTGTTTACTCATGATTGTTAACAAAGCCTACGCTAGAGAGTTTATGGTCGGTGG
TGCAAAAGGTTGGACCGTTCCTTCGGGATCTCAAGTTTACAGTCAATGGGCAGAAGAGAGCAGATTCCAAGTCGGCGACT
CTCTGCTGTTCGTCTACCAACCAAACCAAGATTCAGTGTTCCAAGTCACAAGAGACGCTTACGACAGCTGCAACACTGAT
GCACCAACCGCTAAATTCGCTGATGGCAAAACATCCTTCGCACTAACCCACTCCGGACCATACTATTTCATCAGCGGAAA
CAAAAACAACTGCAACAAAAACGAGAAGCTCGTGGTCATTGTCATGGCTGACAGAAACGGCAAGACCACATCATCATCAT
CACCACCGTCTCAAGCCCCGGCTCCCTCAGGAGAAGCCGCTCCTTCTCCGCCTATCACAAGTAACCTTGAGCCCCCAGCA
ACTACGCCTACTCGAGAAACTCCAAACAACGCAGCTTCCTCATTTTCTTCCTTTGTCTCTGCTCTTCTCGGGGCTGCTCT
TGCTTCCACTCTATTCCTACACTAA