Details for Chinese cabbage Locus Brara.A02812

Position : A01 ( 5`- 23956917 .. 23958105 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02812

Protein [Map View]
MASSTLFKFHSQTFKTLNPSPPSSNHPTSRISHLHFPTSLSRHSPRLNKESTTRTRFLAPLCSSLPSPPVSKEEAILQAK
TCLSSCLLKPLNNPKLASPKLKKLKQPRFRLEIPILDDDSPSSLSQLAFSIFSDMPISRRGSNSVKLLFLWPDPSFVEPA
VKAFRSDNTNHIAMSPVSEPLNKALKSADVAVFMAPERSQLEDVRLSTEGFATKPVVMINPRWLFEEEKSFGDDFVGSFD
VVYAFTGLEVRGILSKRKGVIFKCVRDGVVSGERWNVLVEEEEGDGALRVVSQFKARPSMEEVELVLYNLMAMNSPITKS
AKFLKDLVSNITGKK*

DNA
ATGGCTTCTTCTACCCTCTTCAAGTTCCATTCACAGACCTTCAAAACTCTAAACCCATCACCTCCTTCATCAAACCATCC
TACGTCCAGAATCTCACATCTTCATTTCCCCACATCACTCTCACGCCATTCACCACGGCTCAACAAAGAATCCACCACCA
GAACTCGTTTCTTGGCTCCTCTCTGCTCCTCTCTCCCTTCTCCTCCCGTCTCCAAAGAAGAAGCCATCCTCCAAGCCAAG
ACTTGCCTCTCTTCTTGTCTCCTCAAACCCCTCAACAACCCCAAGCTCGCTTCCCCAAAGCTCAAGAAACTCAAACAGCC
ACGGTTCCGCCTCGAGATCCCCATCCTCGACGACGACTCGCCTTCCTCCCTCTCCCAGCTCGCGTTTTCGATCTTCAGCG
ACATGCCCATCTCGAGAAGAGGCTCCAACTCCGTCAAGCTCCTCTTCCTCTGGCCAGACCCTTCTTTCGTCGAACCAGCA
GTCAAAGCTTTCCGCTCCGACAACACCAACCACATCGCCATGTCTCCCGTTTCAGAACCACTCAACAAGGCTCTAAAATC
TGCTGACGTGGCGGTATTCATGGCTCCCGAGAGATCGCAGCTGGAAGACGTGAGGTTATCTACAGAAGGATTCGCCACGA
AGCCTGTGGTGATGATCAATCCGAGGTGGTTGTTCGAGGAAGAGAAGAGCTTTGGAGACGACTTCGTGGGTTCGTTTGAT
GTGGTTTACGCGTTTACGGGTTTGGAAGTGAGGGGGATACTGAGCAAGAGGAAAGGAGTGATCTTTAAGTGTGTGAGAGA
CGGTGTTGTGAGTGGTGAGAGGTGGAACGTTCTCGTTGAAGAGGAAGAAGGGGATGGAGCCTTGAGAGTGGTCTCGCAGT
TCAAAGCTAGGCCTTCTATGGAGGAAGTTGAGCTTGTTTTGTATAACTTGATGGCTATGAACTCACCTATCACCAAATCA
GCTAAGTTCCTTAAGGATTTGGTTTCTAATATCACTGGGAAGAAGTAG