Details for Chinese cabbage Locus Brara.A02810

Position : A01 ( 5`- 23940400 .. 23948115 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02810

Protein [Map View]
MESILARALEYTLKYWLKSFTRDQFKLQGRTAQLSNLDINGEAIHASMGLPPALSVTTAKVGKLEIMLPYVSNVQTEPIV
VQIDKLDLVLEENPDADVTKGPSSAQSPTASGKSNGYGFADKIADGMTLQVKVVNLLLETGGGAHREGGAAWAAPLASIT
IRNLVLYTTNENWKVVNLKEARDFSTNTGFIYLFKKLEWEALSIDLLPHPDMFTDANLARSEESNLRDDDGAKRVFFGGE
RFLDGISGQAHITVQRTALNSPLGLEVQLHIPEAVCPSLSEPGLRALLRFLTGMYLCLNRGDVDPKSQQSAEAAGRSLVS
VLVDHVFLCIKDAEFQLELLMQSLLFSRACVSDGESANYLTKILIGGLFLRDAFSRSPCALIQPSMKAAAEDLAVPDFAK
NFCPVIYPLDNGPWQLIQDVPLISLHSLQVKPSPKPPHLFSKTVIQCQPLMVHLQEEACLRISSFLADGIVVNPGDVLPD
NSVNSLLFTLKELDVSVPLDMSNLEDSAIKEDLSTKKIFSGARLHIENLSFAESPTLKVRLLNLEKDPACFSLWPGQPID
ASQKKWTAGVSHFSLALETSPNSTEHQNSRGPEMGLWNCVEGKDVCIEVAMVSADGKPLITIPPPGGIVRVGVACEQYIS
NASVEQLFFVLDLYSYFGKVSEKISIVKESKRQNTASLTGGLLEKVPSDTAVKLALKDLQLKFLESSFTSTQDIPLVQFL
GKDLVVKVTHRTLGGAIAVSSNVYWENIEVDCVDTEVQQEHENSCNGDLVVCNGSTPLRRVFWIVNGRHDGHSGSSLVTP
FLDISITNVIPLSEKDMECHSLSIMACISGVRLGGGMNYTEALLHRFGILSLDGGPGEGLSRGLEHLSSGPLSKIFKASI
VDDRKQDGALGSRSGDAFAHLGTPDDIDVCIELRDWLFALEGREGVAERWGSIDDEDIGREERCWHTNFRSFRVIAKSTP
KLVDPNVTETKNDAHKFPVDSIIVNVEGLQILKPQMQKETIPNGHHENGHLPGGVNIEANIVASEDKSGHDDTLSWVAES
LKFSVKQPVEAVVTKDELQHLTFLCKSEVDSMGRIVAGVLRVLKLEESVGHAALNQLSNLGSEGFDKMFSPKASRAGTPR
SSPFGAASDSMREFSSRADLESTISSIEEASVELEAKCSALASDLSDSESETSAKHIKDMKQKLESLQSLMAKLRTQI*

DNA
ATGGAGTCGATACTGGCACGGGCCTTGGAGTATACTCTCAAGTATTGGCTCAAATCATTCACCAGAGATCAATTCAAGCT
TCAAGGCCGCACCGCTCAGCTTTCTAATTTAGACATTAATGGGGAAGCTATACACGCCAGTATGGGTTTGCCTCCTGCCC
TTAGTGTCACCACTGCCAAAGTTGGCAAATTGGAGATCATGCTTCCATATGTGAGTAATGTGCAAACGGAGCCTATAGTT
GTGCAGATCGATAAACTCGATCTTGTTCTTGAAGAGAATCCTGATGCTGACGTGACAAAGGGTCCAAGCAGTGCTCAGTC
TCCCACCGCCTCTGGAAAAAGTAACGGTTATGGATTCGCTGACAAGATTGCAGATGGAATGACTTTACAAGTTAAGGTGG
TCAATCTTCTTCTTGAAACAGGTGGTGGTGCTCACCGTGAAGGAGGGGCAGCCTGGGCTGCTCCACTGGCATCTATTACA
ATACGCAACCTTGTTCTGTACACCACTAATGAGAATTGGAAGGTTGTAAATCTGAAAGAAGCAAGAGACTTCTCTACTAA
CACAGGATTTATTTATTTGTTTAAGAAACTTGAATGGGAAGCTTTATCAATTGATCTTCTGCCGCATCCTGATATGTTCA
CCGACGCTAATTTAGCCCGTTCTGAAGAATCAAATTTGAGAGATGATGATGGGGCAAAACGAGTTTTCTTTGGCGGAGAA
CGCTTTCTAGATGGAATTTCTGGCCAAGCACATATCACAGTTCAGAGAACAGCACTAAACAGTCCACTTGGGCTTGAAGT
CCAGTTGCACATTCCAGAAGCTGTTTGTCCATCGTTAAGTGAACCAGGGTTACGCGCTCTTCTCCGCTTTCTAACTGGAA
TGTATCTATGCCTAAACCGAGGAGATGTGGATCCAAAATCTCAGCAGTCTGCTGAAGCAGCAGGACGGTCTTTGGTCTCT
GTTCTTGTGGACCATGTGTTTCTTTGCATTAAAGATGCCGAATTCCAACTGGAACTACTGATGCAATCACTCCTCTTTTC
TCGGGCCTGTGTTTCGGACGGAGAATCAGCCAACTATTTGACTAAGATTTTGATTGGTGGTCTATTTTTAAGGGATGCTT
TTTCCCGCTCTCCTTGTGCTCTTATCCAACCATCTATGAAAGCTGCTGCCGAAGACCTTGCAGTTCCTGACTTCGCCAAG
AACTTTTGTCCTGTCATATATCCATTGGACAACGGGCCGTGGCAATTAATCCAGGATGTACCCTTGATCTCCTTACACTC
TCTTCAGGTCAAGCCATCCCCAAAACCCCCACACCTATTCTCAAAGACGGTTATCCAGTGCCAACCACTCATGGTTCATC
TTCAGGAAGAAGCTTGTTTAAGGATCTCTTCTTTTTTGGCTGATGGCATAGTTGTGAACCCCGGTGATGTTTTGCCAGAT
AATTCCGTTAACTCTCTTCTTTTCACCCTCAAAGAGTTAGATGTCTCTGTTCCATTAGACATGAGTAACTTGGAAGACTC
AGCAATCAAAGAAGATCTTTCAACAAAAAAGATCTTCTCTGGAGCAAGGCTTCATATTGAAAACTTATCTTTTGCGGAAT
CTCCTACCCTGAAAGTTCGGTTACTAAACCTGGAGAAGGATCCTGCTTGCTTCTCTCTATGGCCGGGGCAGCCTATTGAC
GCCAGCCAAAAGAAATGGACAGCTGGAGTCTCACATTTTAGTTTGGCTTTGGAAACATCTCCCAACTCTACTGAACATCA
GAACTCTCGTGGTCCGGAAATGGGTTTATGGAACTGTGTTGAAGGAAAAGACGTGTGTATAGAAGTTGCTATGGTTTCTG
CGGATGGGAAGCCACTGATAACAATTCCTCCTCCTGGTGGTATTGTACGCGTAGGAGTTGCTTGTGAGCAATACATTTCG
AATGCTTCAGTGGAGCAGTTATTTTTTGTGCTGGACCTCTATTCTTACTTTGGTAAGGTCAGTGAAAAGATCTCAATTGT
TAAAGAAAGCAAACGCCAGAATACTGCTTCTTTGACTGGAGGGTTGTTGGAGAAGGTTCCTAGCGATACAGCTGTAAAAT
TAGCTTTGAAGGATCTGCAGCTGAAGTTTCTCGAGTCTTCCTTTACTAGTACTCAGGACATTCCACTCGTTCAGTTTCTT
GGCAAAGATCTTGTTGTGAAGGTAACTCATAGAACCCTTGGAGGCGCTATTGCAGTATCTTCCAACGTATACTGGGAAAA
TATTGAGGTAGATTGTGTAGATACCGAGGTACAACAAGAACATGAGAATAGCTGTAATGGTGACTTAGTTGTCTGTAATG
GGTCAACCCCATTGAGGCGTGTCTTTTGGATTGTCAACGGAAGACATGATGGGCATAGTGGCAGCAGTCTTGTGACGCCT
TTTCTTGACATAAGCATAACCAATGTGATTCCCCTCAGTGAAAAGGACATGGAGTGCCATAGTTTAAGTATCATGGCTTG
TATTTCAGGCGTGCGTCTAGGAGGAGGAATGAACTACACTGAAGCTCTTTTACATAGATTTGGAATTCTGAGCCTTGATG
GTGGTCCAGGAGAGGGACTGTCTAGAGGGTTAGAGCATTTATCTTCTGGACCGTTGTCAAAAATTTTCAAAGCATCTATT
GTTGATGACAGGAAACAAGATGGAGCTCTAGGAAGTAGGAGCGGAGATGCTTTCGCACATTTGGGAACGCCAGATGATAT
TGATGTCTGCATTGAGTTAAGAGACTGGTTGTTTGCTTTGGAGGGTAGAGAAGGTGTGGCAGAAAGGTGGGGGTCTATCG
ATGATGAAGATATTGGAAGGGAAGAAAGGTGTTGGCACACGAATTTCCGTTCTTTCAGAGTAATAGCCAAGAGTACACCA
AAGCTTGTGGATCCAAATGTGACAGAGACCAAGAATGATGCTCACAAATTTCCTGTAGACTCAATTATTGTCAATGTGGA
AGGTCTGCAGATATTGAAGCCTCAGATGCAGAAAGAAACCATTCCAAATGGACATCACGAAAATGGTCACCTGCCTGGAG
GAGTAAACATTGAAGCTAACATTGTGGCATCTGAAGACAAATCTGGTCATGATGACACGTTGAGCTGGGTGGCAGAAAGT
CTGAAATTCTCTGTTAAGCAACCTGTTGAAGCAGTTGTTACGAAGGACGAGCTGCAACATCTGACATTCTTGTGCAAATC
TGAAGTTGACTCGATGGGTAGGATAGTCGCAGGCGTTCTACGCGTGCTGAAGCTTGAAGAATCAGTTGGACATGCAGCTC
TAAATCAACTAAGCAACCTTGGAAGTGAAGGTTTTGACAAGATGTTCTCCCCAAAAGCCAGCAGAGCAGGCACTCCCAGA
AGCTCACCTTTTGGTGCAGCATCAGATTCAATGAGAGAATTTTCTTCACGTGCAGACCTGGAATCTACCATTTCCTCCAT
TGAAGAAGCATCAGTGGAGCTAGAGGCCAAGTGTTCAGCTCTAGCTTCTGATCTCAGCGATTCAGAATCAGAAACTTCAG
CAAAACACATCAAAGACATGAAGCAGAAACTCGAGAGCTTGCAGAGCTTGATGGCTAAACTACGAACCCAAATCTAA