Details for Chinese cabbage Locus Brara.A02809

Position : A01 ( 5`- 23938541 .. 23940603 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02809

Protein [Map View]
MAAYGENLIVSKPYLFDPSLYIKALKLCSCQNVEKQFVLIHGNSVTNGFVSNLQLNNSLLNLYLRQGDVKHARKLFDRMP
KRDVGSWTAMISGYSQRGYHRRALLLFKEMRREPLRANDFTYGSVLKSCKDLGCLREGMQIHGCVEKGKFTGNLVVRSAL
LCLYAKCGKMKDVRLLFESMKQRDLISWNIMINGYAVSACADTSFSLFQSMLAEGKTPDCFTFESLFRASIQVKCLEMVS
ELHGFAIKLGLERSHELIRSLIDAYGKCGSLVNARKLVEGPMRRDLISCTSLITGFAQQNSFTSDAFDIFKEMIMMRNQM
DEVVVSSMLKICTTIASSSIGRQIHCFALKSSQIRFDVALCNSLIDMYAKSGEIEDAVLAFEEMEERDVRSWTSLISGYG
RHGNVKKAIDLFNRMEHEGTKPNDVTFLALLSACSHTGETELGWKVFNTMINNKYGIKVREEHLSCMVDMLARGGNLEEA
YELIRSENSITSLSSSAWGAFLDACRRHGDMHLSEVAAAQLLSMEPKKPVNYINLASVYAETCDWDNALKTRKLMRESGS
CNKAPGYSIVY*

DNA
ATGGCTGCTTATGGGGAGAATCTGATTGTTTCGAAACCATACTTATTTGACCCTTCCTTGTACATCAAGGCTCTCAAACT
ATGCAGCTGCCAAAACGTCGAGAAACAGTTTGTGTTGATCCATGGGAACTCTGTGACAAATGGGTTTGTCTCCAATCTCC
AGTTGAACAACAGTTTGTTGAACTTGTACCTAAGACAAGGAGATGTGAAACACGCACGCAAACTGTTCGATAGAATGCCT
AAAAGAGATGTTGGTTCTTGGACTGCTATGATCTCGGGATATTCTCAACGTGGATACCACCGGCGGGCGTTGCTGTTGTT
CAAAGAGATGCGCCGGGAACCTCTTAGGGCTAATGATTTCACTTACGGGAGTGTTTTAAAGTCGTGCAAAGATTTGGGAT
GCCTGAGAGAAGGTATGCAGATACATGGTTGTGTGGAGAAGGGTAAATTTACAGGGAACTTAGTTGTGAGGAGTGCATTG
CTTTGTCTTTATGCTAAGTGTGGGAAGATGAAGGATGTTCGTCTTCTGTTTGAATCGATGAAACAAAGGGATTTGATTTC
TTGGAATATAATGATCAATGGGTATGCTGTCTCTGCCTGTGCAGATACTTCCTTTAGTCTGTTTCAGTCGATGCTTGCGG
AAGGGAAGACGCCAGACTGCTTTACCTTTGAGAGCCTCTTCAGAGCTTCTATTCAAGTCAAGTGTCTTGAAATGGTTAGT
GAATTACACGGATTTGCGATCAAGCTGGGTTTGGAGAGATCACATGAACTGATTAGGTCTCTGATTGATGCATATGGGAA
GTGTGGTAGCCTTGTGAACGCTAGGAAACTGGTAGAGGGACCAATGAGAAGAGACTTGATCTCTTGCACTTCTCTAATTA
CAGGTTTTGCACAGCAGAACAGCTTCACAAGTGATGCTTTTGATATCTTCAAAGAGATGATAATGATGAGAAATCAGATG
GACGAGGTTGTAGTATCTTCAATGCTTAAGATATGCACCACCATCGCTTCATCATCCATTGGAAGACAGATCCACTGTTT
CGCCTTAAAATCCTCCCAAATCAGATTCGATGTTGCGTTGTGTAACTCTCTGATAGATATGTATGCAAAGTCTGGGGAGA
TTGAGGATGCAGTCCTCGCTTTTGAAGAGATGGAAGAGAGAGATGTGAGATCATGGACCTCTTTGATTTCAGGATATGGA
AGACATGGGAATGTAAAGAAAGCAATTGATCTTTTCAACAGAATGGAGCATGAAGGGACCAAACCGAATGACGTCACGTT
TCTTGCTCTCCTCTCTGCTTGTAGCCATACAGGAGAAACCGAACTTGGTTGGAAGGTTTTCAACACAATGATCAACAACA
AGTATGGTATCAAAGTTCGAGAAGAGCACTTATCTTGCATGGTAGATATGCTTGCACGCGGTGGCAACTTAGAAGAAGCG
TATGAGCTGATAAGAAGTGAAAACAGCATTACAAGTCTTAGCTCATCAGCATGGGGAGCTTTTCTTGATGCATGCAGGCG
TCATGGGGACATGCATCTTAGTGAAGTAGCGGCCGCGCAGCTTCTGAGTATGGAACCGAAGAAACCGGTCAATTACATTA
ATTTGGCAAGTGTATATGCAGAGACTTGTGACTGGGACAATGCTTTGAAGACTAGAAAGCTTATGAGAGAGAGTGGTTCC
TGCAATAAAGCTCCTGGATACAGCATTGTGTATTGA