Details for Chinese cabbage Locus Brara.A02808

Position : A01 ( 5`- 23936150 .. 23939604 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02808

Protein [Map View]
MSKIALGNESLVGSLTPSNKKSYKVTNRIQEGKKPLYAVVFNFLDSRFFNVFVTAGGNKITLYNCLEDGAISALQSYSDE
DKEESFYTVSWACGVKGNPFVAAGGVKGIIRVIDVNNETIHKSLVGHGDSVNEIRTQPMKPQLVITASKDESVRLWNVET
GICILIFAGAGGHRYEVLSVDFHPTEIYRFASCGMDTTIKIWSMKEFWTYVEKSYTWTDDPSKFPTKFVQFPVFTASVHT
NYVDCNRWFGDFILSKSVDNEILLWEPQLKENSPGEGTSDVLQRYPVPMSDIWFIKFSCDFQLSSLAIGNQEGKIYVWDL
KSCPPVLITKLSHNQSKCVIRQTAMSVDGSTILAACEDGTIWRWDVITK*

DNA
ATGTCGAAGATAGCTTTAGGGAACGAATCACTTGTTGGGTCTTTGACTCCATCTAACAAGAAGTCGTACAAAGTGACCAA
TAGGATTCAAGAAGGGAAGAAGCCTCTGTATGCTGTTGTTTTCAACTTCCTTGATTCTCGTTTCTTCAATGTCTTCGTCA
CCGCTGGTGGAAATAAGATTACGCTGTACAATTGTCTTGAAGATGGTGCCATATCTGCATTGCAATCCTATTCTGATGAA
GATAAGGAGGAGTCGTTTTACACTGTAAGCTGGGCGTGCGGCGTTAAGGGGAACCCATTTGTTGCGGCTGGAGGAGTGAA
AGGCATAATCCGAGTCATTGACGTCAACAATGAAACGATTCATAAGAGCCTTGTGGGCCACGGGGATTCAGTGAACGAAA
TCAGAACACAACCTATGAAACCTCAACTTGTGATTACTGCAAGCAAGGATGAATCTGTTAGGTTGTGGAACGTTGAAACT
GGGATATGTATTCTGATATTTGCTGGAGCCGGAGGTCATCGTTACGAAGTTCTAAGTGTGGACTTTCATCCCACTGAGAT
TTACCGTTTTGCTAGCTGTGGTATGGACACCACTATTAAGATATGGTCAATGAAAGAATTTTGGACTTATGTTGAGAAGT
CATACACATGGACGGATGATCCATCAAAGTTCCCCACAAAGTTTGTACAATTCCCTGTATTTACTGCTTCAGTTCATACA
AACTATGTAGATTGTAACCGTTGGTTTGGTGATTTTATCCTTTCAAAGAGTGTGGACAACGAGATCTTGTTGTGGGAACC
ACAACTGAAAGAGAACTCTCCTGGAGAGGGTACTTCAGATGTTCTACAAAGATACCCGGTTCCAATGTCTGACATCTGGT
TTATCAAGTTTTCATGCGACTTCCAATTAAGTTCTCTTGCAATAGGGAATCAGGAAGGAAAGATTTATGTCTGGGATTTG
AAAAGTTGCCCTCCTGTTTTGATTACAAAGCTGTCACACAATCAATCCAAATGTGTGATCAGGCAAACCGCTATGTCCGT
TGATGGAAGCACAATTCTTGCTGCCTGCGAGGACGGGACCATATGGCGTTGGGACGTGATCACCAAGTAG