Details for Chinese cabbage Locus Brara.A02801

Position : A01 ( 5`- 23836404 .. 23839421 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02801

Protein [Map View]
MNSNNWLGFPLSPNQSSLPPHEYNLGLVSDHMDNPFHTQEWSMINPHGGGEGGEVPKVADFLGVSKPDENQTDHLVAYND
SDYYFHTNSLMPSVQSNDVVVACDSNTPNNSYELQESAHNLQSLTLSMGTTGGNNAAAKASPSEATGDNTSSGALAVVET
ATPRRALDTFGQRTSIYRGVTRHRWTGRYEAHLWDNSCRREGQSRKGRQEAQALESSRKREAEMIALGSSFQYGGGSSSG
GSGSSSSRLQLQPYPLSIQQPLEPFLSLQNNDISHYNTNAHDASSFNHHSYIQTQLHLHQQTNNYLQQQSSQNSQQLYNA
YLQSNPALLHGLVSTSIVDNNNGGSNGSYNTAAFLGNHGIGIGSSSTVGSTEEFPTVKTDYDMPPSDSTGEYGGWTGEPV
QGSNPGGVFTMWNE*

DNA
ATGAATTCAAACAACTGGCTTGGCTTTCCCCTTTCACCAAACCAGTCTTCTTTGCCTCCTCACGAATACAACCTTGGCCT
GGTCAGCGACCATATGGACAACCCTTTCCATACACAAGAGTGGAGTATGATCAATCCACACGGCGGAGGAGAAGGAGGAG
AGGTTCCCAAGGTGGCTGATTTTCTCGGTGTGAGCAAACCAGACGAAAACCAAACCGACCACCTCGTAGCATACAACGAC
TCAGACTACTACTTCCATACCAACAGCTTGATGCCTAGCGTCCAATCAAACGACGTCGTCGTAGCTTGTGACTCTAACAC
TCCTAACAATAGCTATGAGCTTCAAGAGAGTGCTCACAATCTACAGTCATTGACTTTGTCCATGGGGACCACCGGTGGTA
ATAACGCCGCAGCCAAAGCTTCGCCGTCGGAGGCCACCGGCGATAACACTAGCAGTGGTGCACTAGCCGTTGTTGAGACG
GCCACGCCTAGACGTGCTTTGGACACTTTCGGACAACGAACCTCGATATATCGTGGTGTCACAAGGCATCGATGGACCGG
TCGATATGAAGCTCACCTGTGGGATAATAGTTGTAGAAGAGAAGGCCAGTCTAGGAAAGGAAGACAAGAAGCTCAGGCTC
TTGAGTCTTCAAGGAAACGCGAGGCGGAGATGATAGCCCTCGGTTCAAGTTTCCAATATGGTGGTGGCTCGAGCTCAGGA
GGCTCTGGCTCCAGCTCATCAAGGCTTCAGCTTCAACCTTACCCTCTAAGCATTCAACAACCATTGGAGCCTTTTCTATC
TCTACAGAACAATGACATCTCTCACTATAATACCAATGCTCATGATGCTTCCTCCTTTAATCACCATAGCTATATCCAGA
CGCAGCTTCATCTTCACCAACAAACCAACAATTACTTGCAGCAACAATCGAGTCAGAACTCGCAGCAGCTCTATAACGCT
TATCTTCAAAGCAATCCGGCTTTGCTTCATGGTCTTGTCTCTACCTCAATCGTTGACAATAACAATGGAGGATCTAACGG
TAGCTACAACACAGCGGCATTTCTTGGGAACCACGGCATTGGTATTGGGTCGAGCTCCACCGTTGGATCTACCGAGGAGT
TTCCAACTGTTAAAACAGACTACGATATGCCTCCGAGTGATAGCACAGGAGAGTACGGTGGTTGGACTGGTGAGCCTGTT
CAGGGGTCGAATCCTGGTGGTGTTTTCACTATGTGGAATGAGTGA