Details for Chinese cabbage Locus Brara.A02798

Position : A01 ( 5`- 23800963 .. 23801388 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02798

Protein [Map View]
MPSQKARKPNRAEKKLKRTHFKKPLPQHKNTDTTSILDHASSSSMVSSCSSTTTSSSHQDTNNYVPSPSPAVLTSLSPGE
GGGGGGYCTPKAHKHRIPELLTCPPAPKKQRVPQNCVLRRRQIVFFAPPEIELFFVKAGDQ*

DNA
ATGCCATCACAAAAGGCAAGAAAACCAAACCGAGCCGAGAAGAAACTCAAAAGAACTCATTTCAAGAAACCACTTCCACA
ACACAAGAACACGGACACAACTAGTATTCTAGATCATGCTTCTTCATCCAGTATGGTTTCTTCGTGTTCTTCAACAACGA
CGTCTTCTTCTCATCAAGATACAAACAACTATGTTCCCTCTCCTTCTCCGGCGGTGCTGACGTCGTTATCACCAGGTGAA
GGTGGTGGTGGCGGCGGTTATTGTACCCCTAAAGCTCATAAGCATCGGATACCGGAGTTGTTGACTTGTCCACCGGCGCC
GAAGAAGCAAAGAGTCCCACAGAACTGCGTGTTACGACGGAGGCAGATCGTTTTCTTTGCTCCTCCGGAGATCGAGCTCT
TCTTCGTCAAAGCAGGGGATCAATGA