Details for Chinese cabbage Locus Brara.A02796

Position : A01 ( 5`- 23794302 .. 23796813 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02796

Protein [Map View]
MKRPVGAEKKRVKRSSGSASTAARDSGSDAPPRKKGVKKDLFQMFAEKVRDHKGLESRWAVMEQARVEYFRGKDFVNFIK
NNPECKEVLEEDKDLDTEDIANVLLEKNLLVRCDRVTKTLRPGKKKLSTWPAHLEIFREDQAFSETDAFFAWTFEKRHPL
WQTLLSFFWPVLTLAICLFPVYPHRCKLIVLYSCAGILLMILSLLFVRAVAFGAMWILLGKRVWFFPNILAEEATLKELF
RFWPKKDEEEPPKWTSRLFYTVVAVVVVMLLRRHAPDEAARARYQRRMSNIIDDVLEWSPKLALSGLMENQPPVNITEAA
NNSSDAASPDHTEEADVDETQSEEEAEDWTNSNIKT*

DNA
ATGAAGAGGCCGGTCGGAGCCGAGAAGAAAAGGGTTAAACGATCATCGGGATCTGCATCCACCGCCGCTAGAGATTCCGG
TTCTGATGCTCCACCAAGGAAGAAAGGTGTGAAGAAGGATTTGTTTCAGATGTTTGCTGAGAAAGTTAGAGACCACAAGG
GGTTGGAATCAAGATGGGCTGTTATGGAGCAAGCGCGTGTAGAGTACTTCAGAGGCAAAGATTTCGTCAACTTCATTAAG
AACAACCCCGAGTGTAAAGAGGTTCTAGAAGAAGATAAAGACCTCGACACTGAAGATATCGCCAATGTGTTGTTGGAGAA
GAACCTTTTGGTTCGCTGTGATCGTGTTACCAAAACCCTCCGTCCCGGGAAGAAAAAGCTCTCTACTTGGCCTGCTCATC
TTGAGATTTTCCGTGAAGATCAAGCTTTCTCTGAGACTGATGCCTTTTTTGCATGGACGTTTGAGAAACGGCATCCACTC
TGGCAAACGCTTTTGTCCTTCTTCTGGCCTGTGTTGACTCTTGCAATCTGTTTGTTTCCTGTCTACCCACACCGTTGCAA
GCTCATTGTTCTCTACTCATGTGCCGGCATTCTTTTGATGATTCTCTCCTTGCTTTTCGTGAGAGCAGTTGCTTTCGGTG
CTATGTGGATTCTTCTTGGAAAGCGTGTCTGGTTCTTCCCCAACATTCTTGCGGAGGAAGCCACATTGAAGGAACTGTTC
CGTTTCTGGCCAAAGAAAGACGAGGAAGAACCGCCCAAGTGGACATCTCGACTTTTCTACACAGTTGTGGCTGTTGTTGT
TGTCATGCTTCTCAGGCGCCATGCCCCTGATGAGGCTGCTCGAGCTAGGTACCAAAGAAGGATGTCCAACATCATTGATG
ATGTCCTTGAGTGGTCCCCAAAGCTAGCACTCTCTGGTTTGATGGAGAATCAGCCACCGGTGAACATCACAGAGGCCGCT
AACAACTCCTCAGATGCAGCAAGTCCCGACCATACTGAAGAAGCTGACGTAGACGAAACACAAAGCGAGGAGGAAGCTGA
AGACTGGACCAACTCTAATATAAAAACATAA