Details for Chinese cabbage Locus Brara.A02790

Position : A01 ( 5`- 23726177 .. 23729617 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02790

Protein [Map View]
MDPGDPTSILFTKIRTLEPDFASKIIGYLLLQDLGNRDLMRLALGPDTLLHSVCLKAKSALGLSSNGSSSSSISRPINIH
RHSPRTNGFMEFSRNPLSPSVNANVGSSQFQESSSLFASDGVNGDVLDEQQLGDYLSFLNNNDESADLFDNGDAHLHKRS
FSASDVCETGFGGGGYSRFAHGGGLGDDFDSLPGGFGSPDYVSRQQEEIARMKLAQRQRMAAAQFLAASGGSPMSYDSKD
INFLLHSRNGYRSGQFGDEGYWFGSPGRHERDEFMGMMGDKSNSASKQIYLTFPADSSFTDEDVSNYFGNFGGVQDVRIP
YQQKRMFGFVTFVHSETVRTILARGNPHFICDSRVLVKPYKEKGRILENRRQQQQLLQQMERGNFSPGSSPSGLDLFDSH
LAPRMFSNTQEMMMMRRKAEEAELQQAFEFQRRRLLNLHLPDMDSELFHHHQRSLSIGSPVRFPSRSANQSMLFRSENAG
EEVIQGNGDSGRFQSEANHAFLTDTDNNNNQEGGYSNHLNNQEGGYSNHLNNGNETSLENALPDCFFASPSKTAETQQPE
SEKENCATSTIQTS*

DNA
ATGGATCCTGGAGATCCCACTTCGATACTCTTCACAAAGATCAGAACTTTAGAACCAGACTTCGCCTCCAAGATCATTGG
CTACTTGCTCTTACAAGACTTGGGTAACAGAGACTTGATGCGTCTCGCTCTCGGACCCGACACTCTCTTACACTCCGTCT
GTCTCAAGGCTAAATCCGCTTTGGGTCTCTCCTCAAACGGATCTTCTTCTTCTTCTATCTCCAGACCCATTAACATCCAC
CGTCATTCCCCCAGGACGAATGGGTTTATGGAGTTCTCGAGAAACCCTCTGTCTCCTTCGGTGAACGCCAACGTGGGTTC
GAGCCAGTTTCAAGAAAGTTCGTCTCTTTTCGCTTCAGATGGTGTAAACGGCGACGTACTCGATGAGCAGCAACTCGGTG
ACTACTTGTCCTTTCTCAACAACAACGACGAATCTGCGGATCTGTTCGACAATGGCGATGCCCATTTGCACAAGAGGAGT
TTCTCTGCCAGTGATGTTTGTGAGACCGGGTTTGGCGGCGGCGGTTACAGTCGGTTCGCTCACGGCGGTGGTTTAGGGGA
TGATTTCGATTCTCTTCCTGGTGGGTTTGGCTCGCCGGATTACGTTAGCAGACAGCAAGAGGAGATAGCGAGGATGAAAC
TTGCTCAGCGGCAGAGAATGGCCGCTGCTCAGTTCTTGGCGGCTAGTGGCGGTTCTCCAATGTCGTATGATAGTAAAGAT
ATTAACTTTCTCTTGCATTCGCGTAACGGGTACAGATCAGGACAGTTTGGGGATGAGGGTTACTGGTTCGGTAGTCCAGG
GAGACATGAAAGGGATGAGTTTATGGGGATGATGGGAGATAAGTCCAACTCTGCATCTAAACAGATTTACTTGACGTTTC
CAGCTGATAGTTCCTTCACAGATGAAGATGTCTCCAACTACTTTGGGAATTTTGGAGGAGTGCAAGATGTTAGGATACCA
TACCAGCAGAAACGGATGTTTGGGTTTGTCACTTTTGTCCACTCTGAAACTGTGAGAACCATATTGGCTAGAGGAAACCC
TCATTTCATCTGCGACTCACGTGTGCTCGTTAAACCCTACAAGGAGAAAGGAAGAATCCTTGAAAATAGGAGGCAGCAGC
AACAATTGCTGCAGCAGATGGAGAGAGGGAACTTTTCTCCTGGTTCAAGTCCATCTGGATTGGATCTCTTTGATTCCCAC
CTCGCACCGAGGATGTTCTCAAACACACAGGAGATGATGATGATGAGGAGAAAAGCTGAGGAAGCTGAGCTGCAACAAGC
ATTTGAATTCCAAAGGAGAAGATTGCTTAATCTGCATTTGCCCGACATGGATAGCGAGTTGTTTCACCATCACCAGCGCA
GTCTCTCTATTGGCTCTCCTGTTCGTTTCCCCTCTCGCAGTGCTAATCAAAGCATGCTCTTTCGATCTGAAAACGCTGGC
GAAGAAGTCATACAAGGTAATGGTGATTCAGGGCGTTTTCAGTCTGAAGCAAACCATGCTTTTCTGACTGATACTGATAA
TAACAACAACCAAGAAGGTGGTTACAGTAACCATCTCAACAACCAAGAAGGTGGTTACAGTAACCATCTCAACAACGGGA
ACGAGACAAGTCTGGAGAACGCTCTGCCTGATTGCTTCTTTGCTTCCCCATCAAAGACCGCTGAAACCCAACAGCCGGAG
TCTGAGAAAGAGAACTGTGCCACCTCAACAATTCAAACATCCTAG