Details for Chinese cabbage Locus Brara.A02789

Position : A01 ( 5`- 23723661 .. 23726770 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02789

Protein [Map View]
MAQCVRSTLTPSRTPQSFFTRTVSAKTQAFASVSFLRTLPEFKGYPKQCSVVMSCQGNAQRQQQLSLDDLVTSNRKGEVL
GTIKDSLSNCLSDTNLLETVPGLKSRIKGKVRDIYDAGDYLVLITTDRLSAFDRNLASIPFKGQVLNETSLWWFNNTQHI
TPNAIVSSPDRNVVIAKKCSVFPIEFVVRGYVTGSTDTSLWTVYKKGVRNYCGNELSDGLVKNQKLPANILTPTTKAEDH
DVPISPTEIVEGGFMTQAEFDEASLKALSLFEFGQRVAKEHGLILVDTKYEFGKSSDGSILLIDEIHTPDSSRYWLAGSY
EERFRKGLEPENVDKEFLRLWFKENCNPYEDEVLPAAPAELVTELAWRYIFLYETITGSRIDILPTQEPIHDRISRNTSQ
ALSSLRQL*

DNA
ATGGCTCAGTGTGTGAGGTCAACACTAACTCCTTCGAGAACACCCCAGAGCTTTTTTACTAGGACTGTGTCCGCAAAAAC
CCAAGCTTTTGCATCAGTCTCCTTCCTCAGAACACTGCCTGAGTTCAAGGGATACCCAAAACAGTGTTCAGTGGTTATGT
CTTGCCAGGGAAATGCTCAAAGGCAGCAGCAGTTGTCTCTTGACGATCTAGTCACGAGTAACCGTAAAGGAGAGGTTCTT
GGCACTATCAAAGACTCGCTTTCTAACTGTCTCTCAGATACCAATTTGCTAGAGACTGTTCCTGGTCTCAAATCTAGAAT
CAAGGGCAAGGTCAGAGATATCTATGACGCTGGTGATTATCTGGTACTTATCACAACTGATCGGTTGAGTGCCTTTGACA
GAAACCTTGCTTCGATTCCCTTCAAAGGCCAGGTTCTTAACGAGACCAGTTTGTGGTGGTTCAATAACACACAGCACATA
ACTCCAAATGCAATTGTTTCATCTCCTGATAGGAATGTTGTTATTGCAAAGAAATGCTCGGTTTTTCCAATAGAGTTTGT
GGTTAGAGGATATGTGACTGGAAGTACTGACACATCTTTATGGACGGTATACAAGAAAGGTGTTAGGAACTATTGTGGAA
ATGAGCTCTCAGATGGATTGGTAAAAAACCAGAAGCTTCCAGCTAATATACTTACTCCAACAACCAAGGCTGAGGATCAT
GATGTGCCCATCTCTCCAACTGAGATAGTTGAAGGTGGATTCATGACTCAAGCTGAATTTGACGAAGCAAGCTTGAAGGC
TTTGAGCTTGTTTGAGTTTGGTCAGCGTGTGGCAAAGGAGCATGGACTGATACTGGTGGACACAAAATATGAGTTTGGAA
AAAGTAGTGATGGCTCCATCTTGTTGATTGATGAGATTCATACGCCGGATTCAAGCAGATACTGGCTTGCTGGTTCTTAT
GAAGAACGCTTCCGGAAAGGTCTTGAGCCTGAAAATGTTGATAAGGAGTTCCTAAGGCTGTGGTTTAAAGAGAATTGCAA
TCCATATGAAGACGAGGTCCTCCCGGCTGCTCCAGCAGAACTCGTAACTGAATTAGCTTGGCGGTACATTTTCTTGTATG
AGACGATCACTGGATCAAGAATTGACATTCTTCCAACACAGGAACCAATACATGATAGAATCTCAAGAAACACAAGCCAA
GCACTTTCATCTCTCCGTCAACTTTAG