Details for Chinese cabbage Locus Brara.A02784

Position : A01 ( 5`- 23698318 .. 23700646 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02784

Protein [Map View]
MGVDLRQVVAGILTITMFVMLGQMLHRDYYDSLQEKAQGDAHDIEFEGSRVSVKDSLVGALEGNKGPWMDDNNDLNPCWP
TLLSDEAVSSKGYVTFSLTNGPEYHISQITDAVMVAKHLGATLVLPDIRGSKPGDERSFEDIYDADKLIKSLENVIKVVK
QLPEQVSLRDIAIVKVPTRVTEDYIKEHIEPIFKSKGNIRVATYFPSVNLRKSSQDGETDPVACLAMFGSLELQPELNAV
VESMIERLRTHSRKSDGRFIAVDLRIEALEKKNCHSTGVGGSKTCYNAQEIAVFLRKLGFAGDTTIYLTQPRWDSSLNIL
KDIFPKTFTKEAIMPASKRSKYLESESSEYENVIDFYISSRSDVFVPAISGLFYANTVGKRIALGKPQVLVPAEISETSS
LATDFISPYISKKNHLAYSCFC*

DNA
ATGGGTGTGGATTTGAGGCAAGTGGTTGCTGGTATTCTCACCATCACCATGTTTGTGATGCTCGGACAGATGCTTCATCG
AGATTACTATGATTCTCTTCAGGAGAAAGCTCAGGGAGATGCACATGATATCGAATTCGAAGGATCAAGAGTTTCTGTGA
AAGATAGTCTTGTGGGAGCCTTAGAAGGAAATAAAGGACCTTGGATGGATGATAACAATGACCTTAATCCTTGTTGGCCA
ACATTACTATCCGATGAAGCGGTATCATCAAAAGGGTATGTTACATTCTCTCTAACGAATGGTCCTGAGTACCATATCTC
TCAGATCACTGATGCTGTAATGGTGGCAAAGCATCTTGGAGCCACACTAGTGCTTCCTGATATAAGAGGAAGCAAACCTG
GTGATGAAAGGAGTTTTGAAGACATTTATGATGCTGATAAACTAATCAAAAGCTTGGAAAACGTCATCAAAGTCGTCAAA
CAATTGCCTGAACAAGTATCTCTAAGAGACATCGCCATTGTTAAAGTCCCTACAAGAGTTACAGAAGACTACATCAAAGA
ACACATTGAACCCATCTTCAAGTCCAAAGGAAACATTCGAGTCGCTACATACTTCCCTTCTGTCAACCTGAGGAAATCCT
CACAAGACGGCGAAACCGATCCTGTGGCTTGTTTGGCAATGTTTGGTTCCTTGGAGTTGCAACCTGAGCTGAACGCAGTA
GTTGAGTCCATGATTGAGAGGTTAAGGACTCACAGCAGGAAATCAGATGGCCGTTTCATAGCTGTTGACCTTAGAATCGA
AGCACTCGAGAAGAAAAATTGTCATTCAACTGGTGTGGGAGGGTCCAAGACTTGTTACAACGCACAAGAGATTGCTGTGT
TCTTGAGGAAGCTTGGATTTGCTGGTGACACAACCATCTATCTGACTCAGCCTAGATGGGACAGTAGCCTCAATATCCTT
AAGGATATCTTCCCAAAAACGTTTACAAAGGAGGCAATAATGCCGGCAAGTAAGAGATCAAAGTACCTTGAATCAGAGAG
TTCTGAGTATGAAAATGTTATTGACTTCTACATAAGCTCAAGAAGCGATGTGTTTGTTCCAGCCATATCTGGTCTGTTCT
ATGCAAACACAGTTGGGAAAAGGATAGCTTTGGGTAAGCCTCAAGTGCTAGTTCCAGCAGAGATCTCAGAGACTTCTTCC
CTTGCTACAGATTTCATCTCTCCTTACATATCAAAGAAGAACCACTTGGCTTATTCATGCTTTTGCTGA