Details for Chinese cabbage Locus Brara.A02783

Position : A01 ( 5`- 23689416 .. 23690966 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02783

Protein [Map View]
MKLLPTQSSALFTLLPSPNFSKPIDKRGFVTPKRYPSPPISLRCSVSTASDTPSTATNHHLSTNHKPFPAEVSRSIMELS
SVGTLSTLTHDGWPLGVGVRFAVEQDGTPVLCLSRSFSPDKRSSLHVQLEQCGLRTPQCTIQGSIARPGDDNALKRVSAT
WRKKFGEEVEEDSLYVVAVDRVLQIEDFMEDGVWVASSDYKNASPDPLRDVAEDIVNQINANNMEDIFRFCNVYVDLDFV
VSETKMIWMDRLGFDLRVWSPRGVYDVRIPFPMEVTDEKGAKSSFNGMSQLAWEVEKSYCPADFNKVKLLKQVVGSSHKG
GQ*

DNA
ATGAAGCTCCTCCCAACCCAATCCTCCGCTCTCTTCACTCTCCTCCCATCTCCGAATTTCTCGAAACCCATCGACAAACG
CGGCTTCGTCACTCCAAAACGATACCCATCTCCTCCAATCTCCCTCCGATGCTCCGTTTCCACCGCTTCAGACACTCCGT
CGACGGCCACCAACCATCATCTCTCTACAAACCACAAGCCCTTCCCGGCGGAGGTTTCGAGGAGCATCATGGAGCTTTCC
TCCGTCGGAACTCTCTCCACCTTGACCCACGACGGCTGGCCCCTCGGCGTCGGAGTTCGCTTCGCCGTTGAACAAGACGG
CACCCCTGTTCTTTGCCTCAGTCGCAGTTTCTCTCCCGACAAAAGGTCTTCCCTTCATGTTCAGTTGGAGCAATGTGGAT
TGAGGACTCCTCAGTGTACGATACAAGGTAGCATTGCTCGACCTGGAGACGATAATGCTCTTAAGCGTGTTAGTGCTACA
TGGAGGAAGAAGTTTGGGGAAGAAGTTGAGGAAGACAGTTTATATGTTGTTGCAGTTGACCGTGTACTCCAAATTGAAGA
CTTCATGGAGGATGGAGTTTGGGTGGCGTCATCAGATTATAAAAATGCGAGTCCTGATCCTCTCCGTGATGTTGCAGAAG
ACATTGTCAACCAGATTAATGCCAACAACATGGAGGACATCTTTCGTTTCTGCAACGTATACGTTGACCTGGACTTTGTG
GTTTCAGAGACAAAGATGATATGGATGGATAGGCTTGGATTCGACCTTCGAGTATGGTCTCCACGAGGTGTATATGACGT
GAGGATTCCGTTTCCAATGGAAGTAACAGATGAAAAGGGAGCAAAATCATCGTTTAATGGAATGTCACAGCTTGCTTGGG
AAGTAGAGAAAAGCTACTGCCCTGCAGATTTCAACAAGGTTAAATTACTGAAGCAAGTAGTTGGATCATCACACAAGGGA
GGACAATAA