Details for Chinese cabbage Locus Brara.A02782

Position : A01 ( 5`- 23679397 .. 23680392 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02782

Protein [Map View]
MNPIQPPPSPMKNRFRKRPDLSLPLPHRDVALAVPLPLPPPPSTTSAPTSGSAISPNVSAAKSLSELERVNRIGSGAGGT
VYKVIHRPTSKPFALKVIYGNHEDNVRRQICCEIEILRSVDHANVVKCHDMFDHNGEIQVLLEFMDGGCLEGVHVSREEE
LSDMSRQILSGLAYLHRHHIVHRDIKPSNLLIDSEKNVKIADFGVSRILAQTMDPCNSSVGTIAYMSPERINTDLNHGRY
NGYAGDVWSLGVSILEFYLGRFPFAVSRQGDWASLMCAICMSQPPEAPATASEEFRHFVSCCLQSDPPKRWSAQQLLQHP
FILKSTRAPGS*

DNA
ATGAACCCGATTCAGCCCCCTCCTTCCCCGATGAAGAACCGCTTCCGCAAACGTCCTGACCTCAGCCTACCGCTCCCACA
CCGCGACGTAGCCCTCGCTGTGCCTCTCCCCCTCCCTCCTCCTCCCTCCACAACCTCCGCGCCCACGTCAGGCTCCGCCA
TCTCCCCCAACGTCTCCGCCGCGAAAAGCTTGTCCGAGCTAGAACGCGTCAACCGCATCGGAAGCGGCGCGGGGGGAACG
GTTTACAAAGTGATCCACCGTCCGACTTCGAAGCCCTTCGCTCTCAAGGTGATATACGGTAACCACGAAGACAACGTGAG
GCGCCAGATCTGCTGCGAGATAGAGATCTTGCGAAGCGTCGATCACGCCAACGTCGTGAAATGCCACGATATGTTTGATC
ACAACGGGGAGATTCAGGTCTTGCTTGAGTTCATGGACGGAGGATGTCTAGAGGGAGTGCACGTGTCGCGAGAGGAGGAG
CTCTCGGACATGTCTCGGCAGATTCTCAGCGGTTTGGCTTATCTCCACCGTCACCATATCGTCCACCGCGACATCAAGCC
GTCGAATCTTTTGATCGACTCGGAGAAGAACGTTAAGATCGCTGATTTTGGAGTGAGTAGGATCTTGGCGCAGACCATGG
ATCCTTGTAACTCCTCGGTTGGTACCATTGCTTACATGAGCCCCGAGAGGATTAATACCGACCTGAATCATGGACGTTAC
AACGGTTACGCTGGAGATGTGTGGAGTCTTGGTGTTAGCATTTTGGAGTTTTACTTGGGGAGGTTTCCTTTTGCTGTGAG
TAGACAAGGTGACTGGGCGAGTCTAATGTGCGCCATTTGTATGTCTCAGCCGCCTGAAGCTCCGGCCACGGCGTCTGAGG
AGTTTCGTCACTTTGTGTCTTGTTGTTTGCAGAGTGATCCTCCCAAGAGATGGTCTGCGCAACAGCTTCTGCAGCACCCT
TTCATACTCAAATCAACCAGAGCTCCGGGGTCTTAG