Details for Chinese cabbage Locus Brara.A02780

Position : A01 ( 5`- 23649491 .. 23649999 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02780

Protein [Map View]
MKRKRCEMEEAAKEKKITEIGSAIEELSVLSIAKTTIVTTETEATSNIINLPLKPLLSFCKLIIQVLGIYSRIYITKCYA
VFVSFPYFGRVIMLI*

DNA
ATGAAACGCAAGAGATGCGAGATGGAAGAGGCAGCGAAGGAAAAGAAAATAACAGAGATTGGATCAGCCATTGAAGAACT
CTCTGTTCTTTCTATAGCCAAGACCACAATAGTTACCACCGAAACAGAAGCCACCAGCAACATCATCAATCTACCATTAA
AGCCTCTCCTCTCATTTTGCAAATTAATCATCCAAGTTCTTGGTATATATTCAAGAATCTATATTACAAAATGTTATGCA
GTTTTTGTTTCTTTTCCATATTTTGGGCGGGTTATTATGTTAATTTAA