Details for Chinese cabbage Locus Brara.A02777

Position : A01 ( 5`- 23604999 .. 23607611 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02777

Protein [Map View]
MGGMKDEAKRITIPPLFPRVHVNDTERGGLSQPFDGKTMSPYKHSILPSPTDKISDSPSNLSLSLPPPANNACLQTDRSE
MNQLSPTYNTSPASNLEGKVDKKGMIYPSPRGSSVKPSSIKQNEYNLTNLDSLKVPVFRLPETDPKANTDLSLQFHNSST
SKSRGEAAGFKPLLNNLDIRELLLPLQCLEDESNNGSLSVMKTQLYRRRTPKTVPPREQEASDCSAIDSLSGMSAASNDV
ARVIGEKRFWKMRAYMISQQKIFATQVFELHRLIMVQKMVAKSPNLVHKSKINGGSKFKRPNTENQKPVTEAYPEHMKPN
IPLPFISKELMTPIWQQQLLPPQGNQWLVPVMSPSEGLVYKPYAGPCPPPPSAFMVPIYGQDSPSRFPASTQFSHNCFPP
RTTVLDQTNPFGQLQRWSSTSSHMTQAIPFSLKKSQESNDSEVHGSTASSPPEKHKFDVLPLFPTEPTHHTDEYEQKQQP
QCRAIKAIPHNSTSASESAARIFRSIQEERRDSDHMIS*

DNA
ATGGGAGGAATGAAAGATGAGGCGAAGAGGATAACAATTCCTCCATTGTTCCCAAGGGTTCATGTGAATGATACTGAACG
AGGAGGCTTGTCTCAGCCATTTGATGGCAAAACAATGTCTCCATATAAACATTCCATTCTTCCATCTCCGACCGACAAGA
TCTCTGATTCTCCTTCCAATCTCTCACTGTCTCTTCCTCCTCCAGCCAACAACGCTTGTCTCCAGACTGATCGATCTGAA
ATGAATCAGTTATCACCAACCTACAACACTTCTCCAGCATCAAATCTTGAAGGGAAGGTGGATAAAAAAGGCATGATTTA
TCCAAGTCCTAGAGGATCATCAGTTAAACCTAGTTCAATAAAACAAAATGAGTACAACCTTACCAACTTGGATTCTCTTA
AGGTTCCTGTTTTTAGACTCCCGGAGACAGATCCCAAAGCAAACACAGATTTGTCACTACAGTTTCATAATAGCAGTACC
AGTAAATCAAGAGGAGAAGCTGCTGGTTTCAAACCTCTCCTGAACAATCTTGATATTCGAGAATTACTTTTGCCACTACA
ATGTTTGGAAGATGAAAGCAATAATGGGTCTCTTAGTGTGATGAAAACTCAACTGTATAGAAGAAGAACCCCCAAAACTG
TGCCTCCACGTGAGCAAGAAGCCTCAGACTGCTCTGCAATAGACTCTTTGTCTGGTATGAGTGCAGCTTCTAATGATGTT
GCCAGAGTGATAGGTGAGAAGAGATTTTGGAAGATGAGAGCTTATATGATCAGCCAGCAGAAGATCTTTGCCACTCAAGT
CTTTGAGCTGCATAGACTGATAATGGTTCAGAAAATGGTTGCAAAGTCGCCAAACTTGGTTCACAAAAGTAAGATCAATG
GTGGTTCAAAGTTTAAAAGACCAAACACTGAGAATCAAAAACCTGTAACCGAAGCCTATCCAGAGCATATGAAACCAAAT
ATTCCTTTACCTTTCATAAGCAAAGAGCTCATGACCCCAATTTGGCAACAGCAGCTACTTCCTCCACAAGGAAACCAGTG
GTTAGTTCCTGTAATGTCTCCTTCAGAAGGTCTGGTCTATAAACCATACGCAGGTCCATGTCCTCCTCCTCCTTCAGCTT
TCATGGTTCCTATTTATGGACAAGACTCGCCCTCCAGGTTCCCTGCTTCTACTCAGTTTAGCCACAACTGCTTCCCACCG
AGGACAACAGTACTTGACCAGACAAACCCGTTTGGTCAGCTTCAAAGATGGTCAAGCACATCTAGCCACATGACTCAAGC
GATTCCGTTTTCGTTAAAGAAGTCTCAGGAGTCTAATGACAGTGAGGTACATGGAAGTACAGCTTCAAGTCCACCAGAGA
AGCATAAATTTGATGTCCTTCCACTTTTTCCTACAGAGCCTACTCATCACACTGATGAGTATGAGCAGAAACAGCAACCA
CAGTGTCGTGCAATTAAAGCCATTCCTCATAACTCAACATCTGCCTCTGAATCTGCTGCAAGAATTTTCCGTTCTATTCA
GGAAGAAAGGAGGGACTCAGATCATATGATTAGTTAG