Details for Chinese cabbage Locus Brara.A02774

Position : A01 ( 5`- 23539839 .. 23540465 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02774

Protein [Map View]
MDVVARLASQSAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQEMYGKDIEWSLARLGCSPPVPAVFVGGKFVGTANT
VMTLHLDGSLKRLLKEAGALWL*

DNA
ATGGATGTGGTAGCAAGACTAGCGTCACAAAGTGCAGTGGTGATATTTAGCAAGAGTACGTGCTGCATGTCTCATGCAAT
TAAACGGTTGTTTTATGAGCAAGGAGTAAGCCCTGCGATTGTCGAGATCGATCAGGAAATGTACGGTAAAGATATCGAAT
GGTCTTTGGCCCGGTTAGGATGCAGCCCTCCAGTTCCCGCAGTGTTTGTCGGAGGGAAATTCGTTGGTACGGCTAATACC
GTCATGACTCTTCATCTTGATGGGTCATTGAAAAGGTTGCTCAAGGAAGCTGGTGCCTTGTGGCTTTAG