Details for Chinese cabbage Locus Brara.A02771

Position : A01 ( 5`- 23466773 .. 23468253 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02771

Protein [Map View]
MELVQMQKSLQDYTKSLFLDGVLDSQFLQLQQLQDESNPDFVSQVVTLFFQDSDRILNDLSLSLDQQVVDFKKVDPHVHQ
LKGSSSSIGAQRVKNACVVFRNFCEQQNVEGCHRCLQQVKKEYYLVKNRLETLFKLEQQIVASGGMIPAMELGF*

DNA
ATGGAGTTGGTTCAGATGCAGAAGAGTTTGCAAGATTACACTAAATCACTCTTCTTGGATGGGGTTTTGGACAGCCAGTT
CTTGCAGCTGCAACAATTACAAGATGAAAGCAATCCAGATTTTGTTTCACAAGTTGTCACTCTCTTTTTCCAAGATTCTG
ACAGGATCCTCAATGATCTCTCACTGTCCCTAGATCAACAAGTTGTAGACTTCAAAAAAGTTGATCCTCATGTTCATCAA
CTCAAAGGTAGCAGCTCCAGTATAGGAGCACAGAGAGTTAAGAATGCTTGTGTTGTCTTCCGCAACTTCTGCGAGCAACA
AAACGTTGAAGGATGTCATAGATGTTTGCAACAAGTAAAGAAAGAATACTATCTTGTGAAGAACAGGCTAGAGACTCTGT
TCAAGCTCGAGCAACAGATTGTAGCCTCTGGTGGAATGATCCCAGCCATGGAACTCGGATTTTGA