Details for Chinese cabbage Locus Brara.A02760

Position : A01 ( 5`- 23379011 .. 23383155 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02760

Protein [Map View]
MVHVSSHGAKDGSEEAFDYRGNPPDKSKTGGWLGAGLILGSELSERICVMGISMNLVTYLVGDLHISSAKSATIVTNFMG
TLNLLGLLGGFLADAKLGRYKMVAIAASVTALGVLLLTVSTTIPSMRPPPCDDFRRLHHQCVEAKGHQLALLYVALYTIA
LGGGGIKSNVSGFGSDQFDTSDPKEEKQMIFFFNRFYFSISLGSLFAVIVLVYVQDNVGRGWGYGISAATMVVAAVVLLC
GTKLYRFKKPRGSPFTVIWRVGYLAWKKRNEGYPSNPSLLNGYDNTTVPHTERLKCLDKAAVVTNEKDSWSVSTVTQVEE
VKLVVKLIPIWATNILFWTIYSQMTTFTVEQATFMERKVGSFTVPAGSYSAFLILTILLFTSLNERVFVPLTRMITKKPQ
GLTSLQRIGVGLVFSMAAMAVAAVIENARREAEVAKGMKISAFWLIPQYFLVGAGEAFAYVGQLEFFIREAPERMKSMST
GLFLSTVSMGFFVSSLLVSLVDKVTHRSWLRSNLNKGRLNYFYWLLVILGALNFFVFLLFAMKHQYKADMISVGVDDSVE
KGKDSEKEKSEFELKDIP*

DNA
ATGGTTCATGTCTCATCGCATGGAGCAAAAGATGGCTCGGAAGAAGCCTTCGACTACAGAGGAAATCCACCTGATAAGTC
CAAAACCGGTGGATGGTTAGGCGCCGGTTTAATCTTAGGGAGTGAGCTATCGGAGAGAATATGCGTGATGGGCATATCTA
TGAATCTAGTGACGTACCTTGTCGGAGACTTACACATCTCATCAGCAAAATCAGCGACCATAGTCACAAATTTCATGGGA
ACTCTCAACCTCTTGGGACTTCTTGGTGGTTTCTTGGCTGACGCTAAACTCGGTCGCTACAAGATGGTCGCAATAGCTGC
CTCTGTCACAGCTCTGGGAGTGTTGCTATTGACAGTGTCTACAACCATCCCAAGCATGAGACCGCCACCATGTGACGATT
TCAGAAGACTTCACCATCAGTGCGTAGAGGCAAAAGGTCACCAGTTAGCTCTTCTCTACGTCGCTCTCTACACCATAGCT
CTCGGCGGCGGAGGAATCAAATCCAACGTCTCGGGCTTCGGGTCTGACCAGTTCGACACGAGTGATCCTAAAGAAGAGAA
GCAGATGATCTTCTTCTTCAATAGATTCTATTTCTCCATCAGCCTCGGATCTCTCTTCGCCGTGATTGTTCTGGTTTACG
TCCAGGACAACGTGGGAAGAGGCTGGGGCTACGGGATCTCGGCCGCGACTATGGTGGTCGCGGCCGTGGTTTTGCTCTGC
GGAACGAAACTGTACCGTTTCAAGAAACCTAGAGGAAGCCCTTTCACTGTTATATGGAGGGTTGGTTACTTGGCGTGGAA
GAAAAGAAACGAGGGTTACCCTTCAAATCCTAGTCTTTTAAACGGTTACGACAACACAACGGTTCCCCACACCGAGAGGC
TAAAGTGTTTGGACAAAGCCGCGGTTGTCACAAACGAGAAGGATTCGTGGAGCGTGTCGACCGTTACACAGGTCGAAGAA
GTGAAGCTAGTTGTGAAATTGATTCCTATTTGGGCAACGAACATTCTCTTCTGGACGATTTACTCCCAAATGACTACATT
CACAGTGGAACAAGCCACGTTTATGGAGCGTAAAGTCGGGTCTTTCACCGTACCCGCAGGGTCATACTCGGCTTTTCTCA
TTCTCACGATTCTCCTCTTCACTTCCCTTAACGAGAGAGTCTTTGTGCCTTTAACAAGAATGATCACAAAGAAACCTCAA
GGACTCACCAGCCTCCAGAGGATTGGAGTTGGGCTCGTGTTCTCAATGGCTGCAATGGCTGTTGCAGCGGTTATAGAGAA
CGCTAGACGCGAGGCAGAGGTCGCCAAGGGGATGAAGATAAGCGCGTTCTGGTTGATTCCGCAGTATTTCTTGGTTGGTG
CGGGTGAAGCGTTTGCTTACGTTGGACAGCTTGAGTTCTTTATTAGAGAAGCACCAGAGAGGATGAAATCTATGAGCACC
GGATTGTTTCTAAGCACGGTTTCGATGGGATTCTTTGTGAGCAGCTTGCTTGTTTCTCTTGTGGATAAGGTTACACACAG
GAGCTGGCTTAGAAGCAACCTCAACAAAGGGAGATTGAACTACTTCTACTGGTTACTTGTTATCTTGGGAGCATTGAATT
TCTTCGTTTTTCTTCTGTTTGCGATGAAGCATCAGTATAAAGCTGATATGATTAGTGTTGGGGTTGATGATTCTGTGGAG
AAGGGTAAGGATAGCGAAAAAGAAAAGTCTGAGTTTGAGCTTAAGGACATTCCATAA