Details for Chinese cabbage Locus Brara.A02754

Position : A01 ( 5`- 23294711 .. 23296741 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02754

Protein [Map View]
MKTTNRFNVIVAVAATILMGMFESSDAQLQMNFYAKSCPNAEKIISDHIQKHIHNGPSLAAPLIRMHFHDCFVRGCDGSV
LINSTSGNAERDAPPNLTLRGFGFVERIKTLLEAECPKTVSCADIIALTARDSVVATGGPWWSVPTGRRDGRISKLAEAT
NNIPGPTSNFTTLQQRFAKQGLNLKDLVLLSGAHTIGVSHCSSMSERLYNFSTTVKQDPSLDSEYAANIKANKCKSLTDN
TTILEMDPGSSRSFDLSYYRLVLKRRGLFQSDSALTKNLATLKMINDLVNGSEKKFYKAFAKSMEKMGRVKVKTGSAGVI
RTRCSVARS*

DNA
ATGAAGACGACGAATCGCTTCAATGTCATTGTTGCGGTTGCAGCAACGATACTTATGGGAATGTTTGAATCATCCGATGC
TCAGCTTCAAATGAATTTCTACGCGAAAAGCTGTCCAAACGCTGAGAAAATAATTTCAGACCATATTCAAAAGCATATCC
ATAATGGCCCTTCTCTTGCAGCTCCTCTCATCAGAATGCACTTCCATGATTGCTTCGTCAGGGGATGCGATGGATCAGTG
TTGATAAATTCAACATCTGGAAACGCAGAGAGAGATGCACCACCAAATCTAACACTCAGAGGATTCGGTTTCGTAGAGAG
GATTAAAACTCTTCTAGAAGCAGAGTGTCCAAAGACTGTTTCATGCGCTGATATCATCGCTTTGACCGCTCGAGACTCAG
TTGTTGCTACCGGAGGTCCTTGGTGGAGTGTTCCAACCGGAAGAAGAGACGGTAGGATCTCAAAATTGGCTGAGGCTACG
AACAATATTCCCGGACCGACGAGTAACTTCACAACGTTACAACAACGTTTCGCTAAACAAGGCCTTAATCTCAAAGACCT
TGTTCTACTCTCCGGGGCTCACACAATCGGCGTCTCGCATTGTTCTTCCATGAGTGAACGTCTCTACAACTTCTCGACGA
CAGTCAAACAAGATCCATCTCTGGACAGCGAGTACGCAGCGAACATAAAGGCCAACAAATGTAAGAGCCTCACCGACAAC
ACCACCATCCTTGAGATGGATCCCGGTAGCAGTAGAAGCTTCGATCTCAGTTACTACAGGCTTGTCTTGAAAAGGAGAGG
TCTCTTTCAGTCTGATTCTGCTTTGACAAAGAACTTAGCCACGTTAAAGATGATCAACGATTTGGTCAACGGTTCTGAAA
AGAAGTTCTACAAGGCTTTTGCTAAGTCAATGGAAAAGATGGGGAGAGTTAAAGTGAAGACGGGTTCAGCCGGTGTGATC
AGGACACGTTGTTCTGTTGCCCGAAGTTAG