Details for Chinese cabbage Locus Brara.A02752

Position : A01 ( 5`- 23268333 .. 23271910 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02752

Protein [Map View]
MSLYKTKLCILYEKNGDCSKPNCTFAHGVAELRLPGESSSFRGRRHNLDGDLRDKLGRHFSPERRPSLDRSGRRVQRFNG
HENPRSFEKRRDVDYRENRRFDERSDYAGGLKSGSRIEVRERDERNKFLGYNNVLEEQLKDVELDVKMLTDNKLRLEAAV
ERKAREADILTSRIQELRTQLDREKEECKRITSSTKKFVKEYNRFLRAQDDVKRSEARLQKLGTQLSTYLLGNEGNDRET
DIEIVSDEEKNGRNLRSASDLQNELHNTSSVSRKRHYVEQQYTTKESVQDALRGRGEEDKLENGKSPSRWNRVPSKSFSE
EESRVRNEEDAMNKSSSKEDTWKRRRLSSGTSSSNKVMSSTSMAARVSDEVAEFDEENTRAAKGSPLISLPPPPPFRDAH
FHGDEEEAKVDVNEQRKADDVDSV*

DNA
ATGTCTTTGTATAAGACTAAGCTTTGTATTCTGTACGAGAAGAATGGTGACTGCTCGAAGCCTAATTGCACTTTCGCTCA
TGGAGTTGCTGAGCTCCGTCTTCCTGGTGAATCTTCTTCATTCAGAGGCAGACGTCACAATCTTGATGGTGACTTAAGAG
ATAAACTTGGTAGACACTTTTCTCCAGAGCGGAGACCTTCTTTGGACAGAAGTGGAAGAAGAGTACAAAGATTTAATGGA
CATGAAAATCCCAGGTCCTTTGAGAAGCGAAGAGATGTAGACTACAGGGAGAACCGCAGATTTGATGAACGAAGTGATTA
TGCTGGTGGTTTGAAATCTGGAAGTAGGATTGAAGTCAGGGAAAGAGATGAAAGAAATAAGTTTCTGGGCTACAATAATG
TTCTGGAAGAGCAGTTAAAAGATGTAGAGCTGGATGTTAAGATGCTAACTGATAACAAATTACGATTGGAGGCTGCTGTT
GAAAGGAAGGCACGGGAAGCAGACATTCTTACTTCAAGGATCCAGGAGCTTAGGACCCAGTTGGATAGAGAGAAAGAGGA
ATGTAAGAGGATTACTTCAAGCACGAAGAAATTTGTGAAAGAATATAATCGTTTCTTGCGGGCACAAGATGATGTAAAGA
GGTCAGAAGCTCGTCTTCAGAAGTTGGGAACCCAACTGAGTACGTATCTTCTTGGAAATGAAGGCAATGACAGGGAAACA
GACATCGAGATTGTGAGCGATGAAGAGAAAAATGGTCGGAATCTGAGAAGTGCTTCTGATTTGCAAAATGAGCTGCACAA
TACTTCTTCAGTGTCCAGGAAAAGACATTATGTGGAACAACAGTATACTACCAAAGAATCTGTTCAAGATGCCTTGAGAG
GAAGAGGTGAAGAAGATAAGTTGGAGAATGGGAAGAGTCCTTCTCGTTGGAATAGGGTTCCTTCGAAATCATTTTCCGAA
GAGGAAAGTAGAGTGCGGAACGAGGAAGACGCAATGAACAAGTCCTCATCGAAGGAAGACACTTGGAAAAGAAGAAGGCT
TTCTTCTGGCACCTCATCTAGCAATAAGGTAATGTCGTCTACGAGCATGGCAGCTCGGGTATCTGATGAAGTGGCAGAGT
TTGATGAAGAAAATACTCGAGCAGCCAAAGGCTCTCCCCTCATATCTCTTCCTCCACCCCCACCTTTCAGAGATGCCCAT
TTTCATGGAGACGAGGAGGAGGCCAAAGTCGATGTGAATGAACAGAGGAAAGCTGATGACGTTGACTCCGTCTGA