Details for Chinese cabbage Locus Brara.A02751

Position : A01 ( 5`- 23265342 .. 23267736 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02751

Protein [Map View]
MAESSSSSPSEEIVRLIKRLSSYVAFKMSSLFSTPIRNLDSRSIGAIAGLAIAVIFTWRAIRTQPGEPQRRRPKRRLQSP
ESSSAAPDEDNGVQDVVDQFFQPAKPTLGQIVRQRLSEGRKVTCRLLGVILEESSPEELQKQATVRSSVMEVLLEITKCC
DLYLMERVVDDESEAKVLQALETAGIFTSGGLVKDKVLFCSTEIGRTSFVRQLEPDWHIDTNPEISTQLARFIKFQLHVS
AAKPERTVPNVFTSQSIEQFFGCP*

DNA
ATGGCGGAGTCGTCGTCTTCATCACCTAGTGAAGAGATCGTTCGATTAATCAAACGGTTAAGCAGTTACGTTGCTTTCAA
GATGTCTAGCCTCTTCTCTACACCTATTCGCAATCTGGATTCGAGATCTATTGGTGCTATTGCGGGGCTTGCAATAGCTG
TGATATTCACATGGAGGGCCATAAGAACACAACCAGGGGAGCCTCAAAGAAGGCGACCTAAACGCAGGTTGCAATCACCT
GAATCCTCTAGTGCTGCTCCTGATGAGGATAATGGAGTGCAAGATGTTGTTGATCAGTTTTTTCAGCCTGCAAAACCTAC
ATTGGGGCAGATAGTTAGGCAGAGACTTAGTGAAGGAAGGAAGGTAACATGCCGTCTTCTTGGAGTCATTCTTGAGGAAT
CAAGTCCTGAAGAGCTCCAAAAACAAGCAACAGTGAGGTCATCCGTTATGGAAGTTCTCCTTGAGATTACAAAGTGTTGT
GATTTGTATCTCATGGAAAGAGTTGTTGACGATGAAAGCGAAGCCAAAGTTCTACAGGCTCTAGAGACTGCAGGCATTTT
CACATCTGGTGGTTTGGTCAAAGATAAGGTACTGTTTTGTAGTACAGAGATCGGAAGAACATCCTTTGTAAGGCAACTAG
AACCTGACTGGCATATTGATACAAATCCAGAAATCAGCACACAATTAGCTAGGTTCATAAAATTTCAGCTTCACGTCTCT
GCAGCGAAACCAGAGCGAACGGTTCCCAATGTGTTCACCTCACAGTCAATAGAACAGTTCTTTGGATGTCCTTGA