Details for Chinese cabbage Locus Brara.A02750

Position : A01 ( 5`- 23261467 .. 23262883 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02750

Protein [Map View]
MEPKCDYCATTQAIIYCKYDLAKLCLKCDVHVHSPNPLSRRHMRSLICEKCFSQPAVIRCLDQKVSYCQGCQWHVRSCSA
LGHRLQSLEPFSGCPSPTEFSRMWSSILEPSVSSLVNPSIGSLPLADPNNDMFEMSKINELDDLIGSSYSMMSQNITYIQ
NLSDQSSFFSGDSKGCPDLILKLEEGEEDLCEGLNLDNAPLNFDVGDDIICCSPQEHIESDQTLPNGPLAYKNIISVTDS
NFTTDNPLESGPLQMNINIGLPLPTSPILFGQINPNIKGHESTAVEYQDCGMSTGLIMSDSPWESNLEVGSPQTRNEAKL
RYKEKKLKRTFGKQIRYASRKARADTRKRVKGRFVKAGDNYDYDPSSPTTNQ*

DNA
ATGGAGCCGAAATGTGATTATTGTGCAACCACACAGGCAATAATTTACTGCAAATACGATTTGGCTAAACTATGCTTAAA
ATGTGATGTCCATGTACACTCTCCGAATCCTCTGTCTCGCAGACACATGCGTTCTCTGATCTGCGAGAAATGCTTCTCAC
AGCCTGCCGTTATTCGCTGTCTCGACCAGAAGGTTTCATATTGCCAAGGATGCCAATGGCATGTACGCAGCTGCTCTGCT
TTAGGACACAGACTTCAAAGTCTAGAGCCATTCTCCGGTTGTCCTTCTCCAACAGAATTTTCCAGAATGTGGTCTTCAAT
TCTTGAACCTTCTGTTTCCAGTTTGGTTAATCCATCCATTGGTTCTTTGCCCTTGGCTGATCCCAACAATGACATGTTCG
AGATGTCAAAAATCAACGAGCTAGACGATTTGATTGGTTCCTCTTATTCAATGATGTCACAAAACATCACTTACATTCAG
AATCTCAGTGATCAATCATCTTTCTTTTCTGGGGATTCTAAGGGATGTCCTGATTTAATTCTAAAACTTGAAGAAGGCGA
AGAAGATCTGTGCGAGGGACTTAACTTGGACAATGCGCCTTTAAACTTTGACGTTGGAGATGATATCATCTGCTGCTCGC
CACAAGAACACATAGAATCTGATCAAACATTACCAAATGGTCCCTTGGCTTACAAGAACATCATATCTGTTACCGACTCA
AACTTCACTACTGACAACCCTTTAGAGTCAGGTCCGTTGCAAATGAACATCAACATTGGACTTCCTCTTCCGACATCTCC
TATCTTGTTCGGACAGATCAATCCGAACATCAAAGGTCATGAAAGCACTGCAGTGGAATACCAGGATTGTGGTATGTCTA
CAGGGTTGATAATGAGTGATTCGCCATGGGAATCAAATCTTGAAGTTGGTTCTCCACAAACAAGGAATGAAGCTAAGTTG
AGATACAAAGAGAAGAAACTCAAGCGCACTTTTGGGAAACAGATTCGATATGCATCTCGCAAAGCGAGAGCTGACACGAG
AAAAAGAGTGAAAGGAAGATTCGTGAAAGCTGGCGACAATTATGACTATGACCCATCATCACCAACCACGAATCAATGA