Details for Chinese cabbage Locus Brara.A02744

Position : A01 ( 5`- 23196235 .. 23197570 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02744

Protein [Map View]
MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILSKDGVVLIGEKKVTSKLLQTSTSSEKMYKIDDHVACAVAGIM
SDANILINTARVQAQRYTFMYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNHGFQLYMSDPSGNYGGWK
AAAVGANNQAAQSILKQDYKDDATREEAVELALKVLSKTMDSTSLTSEKLELAEVFLTPSGSVKYHVHSPDSLTKLLVKH
GVTQPAAESS*

DNA
ATGTCTCGAAGATATGATAGCCGCACCACAATCTTCTCCCCAGAAGGCCGTCTCTACCAAGTCGAGTACGCCATGGAGGC
CATTGGCAACGCCGGCTCTGCCATCGGTATCTTATCCAAAGACGGCGTCGTTTTGATCGGCGAGAAGAAAGTCACCTCCA
AGCTTCTCCAAACCTCCACCTCCTCTGAGAAAATGTACAAGATCGACGACCACGTCGCCTGTGCTGTCGCTGGTATCATG
TCTGACGCCAACATCCTCATCAACACTGCTAGAGTCCAAGCGCAACGCTACACCTTCATGTACCAGGAGCCCATGCCTGT
TGAGCAGCTTGTTCAGTCTCTCTGTGATACAAAGCAAGGGTACACGCAGTTCGGTGGTCTTCGTCCCTTTGGAGTTTCGT
TTCTTTTTGCAGGGTGGGACAAGAACCATGGGTTTCAGCTGTATATGAGTGACCCCAGTGGGAACTACGGTGGCTGGAAA
GCTGCGGCTGTGGGAGCTAACAACCAGGCGGCTCAGTCTATTCTGAAACAAGATTACAAGGATGATGCAACTAGAGAAGA
GGCGGTGGAGCTTGCTCTGAAGGTTTTGAGCAAGACCATGGACAGCACTAGCTTGACGTCGGAGAAGCTTGAGCTTGCTG
AGGTGTTTCTGACTCCGTCTGGGAGTGTTAAGTACCATGTTCACTCTCCTGACTCGCTCACCAAGCTGTTGGTGAAGCAT
GGTGTGACTCAACCCGCTGCTGAATCATCCTAA