Details for Chinese cabbage Locus Brara.A02743

Position : A01 ( 5`- 23190599 .. 23191270 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02743

Protein [Map View]
MVSLTHNISFLILLFLGVLALSFVCDCSPPKPSPDSHNPPKNPVKPPQSPAVKSPKPPTVKPPPSTSKPPMKPPTIKPPT
HKPPPVVTSPTPCPASTLCPPPSPCPPPTPCPASTLCPPPSPCPPPTPTPTPPVVTPPKPETCPIDTLKLGACVDILGGC
IHMGIGKSYAKETCCPVLGGLFSMDAAICLCTTIEAKFFNMDLIIPIAIEILLDCGKPPPPGFK

DNA
ATGGTGTCTCTCACACACAACATATCCTTTCTCATTCTCTTGTTCCTCGGCGTCCTTGCCCTCTCCTTCGTTTGCGACTG
TAGCCCTCCTAAACCATCACCGGATTCCCACAACCCGCCAAAAAATCCCGTCAAACCGCCTCAGTCACCTGCTGTCAAAT
CGCCAAAACCGCCCACCGTTAAACCACCTCCATCAACCTCTAAACCACCCATGAAACCGCCAACCATTAAACCACCGACC
CACAAGCCTCCACCTGTGGTAACGTCGCCAACACCGTGCCCAGCATCAACACTGTGCCCACCACCATCACCGTGCCCACC
ACCAACACCGTGCCCAGCATCAACACTGTGCCCACCACCATCACCGTGCCCACCACCAACACCAACACCAACTCCACCTG
TCGTAACGCCGCCAAAACCAGAGACTTGCCCAATCGACACGCTGAAATTAGGCGCTTGTGTGGACATTCTTGGAGGTTGC
ATTCACATGGGAATTGGTAAAAGCTACGCTAAGGAAACGTGTTGCCCGGTTTTGGGAGGTTTATTTAGCATGGACGCAGC
CATTTGCCTATGTACTACCATTGAAGCCAAATTTTTCAATATGGACCTCATCATTCCCATTGCTATTGAGATTCTTCTCG
ACTGCGGAAAGCCTCCACCTCCTGGCTTCAAA