Details for Chinese cabbage Locus Brara.A02740

Position : A01 ( 5`- 23161348 .. 23164742 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02740

Protein [Map View]
MVRRHGWQLPADILQMIAVTVFCLLVVAYFAFFAPFAGGRFWEYVLIGVYSPVALLVFVLYVRCTAINPADPRIMTHPLS
ARDISRSFNESGSQLQSCPSGVSMSSTFAANSSVVRGSVGDDERVEDSVTRKSCYNPLAIFCCVFVLDDCWKQEEEQGNS
RVGLYCMFCNCEVHKSSKHCKSCDKCVVGFDHHCKWLNNCVGRKNYMTFVSLITASLLWLIIEAAVGVAVIVRVFADKKR
METEIVNRLGSSFSRAPLAAVVGVCTVVTIPACYHLAQLLFFHTLLIKKGLTTYDYLLAIRAMSEAPAGASVDEEIQSVL
YSPTGSAISGGSSLGPSYRKGVWCSPPRVFDNQDEVIPQLGSHMVPSTVDPERGIKAPKRSVKRSAWKLAKLDANEAARA
AARARASSSVLRPIHNHPHLPDNELSSVAATVSSVSTDANVAARKEMRNNDLKPSLSRNSFAAPSQSSRDEYDDESVTLS
PLPQYSTVNGHRFSTTTDHTHRGNSADPLFLSAPSTSLLRDVRKTSVVWDAEAGRYVSSAPVTTMPEVRNRNQRAILPPQ
GSSSLKAHLPLQQAERRLIYTGDSIFFGGPLVNIQTRNNQRTEVREGQERLASTLHQDARYRRDSTSHKLPVFAPPL*

DNA
ATGGTGAGGAGACACGGCTGGCAACTTCCCGCTGACATTCTTCAGATGATTGCGGTGACGGTGTTTTGCTTGTTGGTGGT
CGCTTACTTTGCTTTCTTCGCTCCTTTTGCCGGAGGACGGTTCTGGGAATACGTTTTGATCGGTGTTTACTCTCCGGTGG
CTCTTCTTGTATTCGTTCTGTATGTTCGGTGTACTGCTATTAATCCTGCGGATCCAAGAATCATGACTCATCCTTTATCG
GCCAGAGATATCTCCAGGAGTTTTAATGAATCTGGCAGTCAGTTGCAGTCTTGTCCTTCAGGTGTCTCAATGAGTTCTAC
CTTTGCAGCAAACTCTAGTGTAGTCAGAGGTTCTGTAGGAGATGATGAAAGAGTGGAGGACTCTGTTACTAGAAAATCTT
GCTATAACCCTCTGGCTATCTTCTGTTGTGTGTTTGTTCTTGATGACTGCTGGAAACAGGAAGAAGAACAGGGAAATAGC
AGGGTGGGTCTATATTGCATGTTTTGCAATTGTGAGGTACATAAGTCTAGCAAGCATTGTAAGAGCTGTGACAAATGTGT
TGTTGGTTTCGATCACCATTGCAAGTGGCTTAACAATTGTGTCGGCCGCAAAAACTACATGACTTTTGTATCTCTGATTA
CTGCCAGCCTTCTCTGGCTCATTATTGAAGCAGCAGTGGGAGTTGCAGTGATTGTGCGTGTATTTGCTGATAAGAAGAGA
ATGGAGACAGAAATTGTCAATAGACTCGGAAGCAGCTTCTCTCGAGCACCTCTTGCGGCTGTTGTTGGTGTTTGCACTGT
TGTTACCATTCCGGCATGTTATCATCTGGCTCAACTTCTCTTTTTCCACACGTTGCTCATTAAAAAGGGACTTACAACAT
ATGATTATTTACTGGCAATAAGAGCCATGAGCGAGGCACCAGCTGGAGCATCTGTTGACGAGGAGATTCAGAGTGTGCTC
TATTCTCCCACCGGATCTGCCATTAGTGGTGGAAGCTCTCTCGGGCCATCATACAGAAAGGGAGTCTGGTGCAGTCCACC
TAGAGTGTTTGATAATCAGGATGAAGTGATTCCCCAACTAGGCTCTCACATGGTCCCGTCTACCGTAGATCCAGAGAGAG
GCATCAAGGCTCCCAAAAGATCCGTCAAACGCAGTGCATGGAAGCTAGCGAAGCTGGACGCAAATGAAGCTGCGAGAGCA
GCTGCCAGAGCCAGAGCATCTTCATCTGTCCTGAGACCAATACACAATCATCCCCATTTACCTGATAATGAACTTAGTTC
CGTTGCCGCCACAGTTAGTAGTGTAAGCACAGATGCAAATGTGGCTGCAAGGAAAGAGATGCGGAACAATGATTTAAAGC
CATCTCTCTCTAGAAACTCGTTTGCTGCACCAAGCCAAAGTAGCCGGGATGAGTATGACGACGAGTCAGTCACACTTTCT
CCTCTCCCTCAATACTCTACAGTAAATGGCCATCGCTTCTCTACAACAACCGATCACACGCACAGAGGAAACAGCGCTGA
TCCACTGTTTCTCTCTGCTCCTTCAACTTCTCTTCTGAGAGATGTGAGGAAGACATCAGTTGTTTGGGATGCTGAAGCTG
GGAGATACGTATCATCAGCTCCTGTAACGACAATGCCTGAAGTCCGTAATAGGAATCAAAGAGCCATTCTTCCACCTCAA
GGTTCATCATCGCTAAAGGCTCATCTTCCTCTGCAGCAAGCCGAGAGAAGACTGATATATACCGGTGACTCTATCTTCTT
CGGAGGACCTCTTGTTAATATCCAGACTAGAAATAACCAGAGGACTGAAGTAAGAGAGGGACAAGAGAGATTGGCATCAA
CACTTCATCAAGATGCAAGATATAGAAGAGATTCAACCTCACACAAGCTTCCAGTGTTTGCCCCTCCACTTTGA