Details for Chinese cabbage Locus Brara.A02739

Position : A01 ( 5`- 23159904 .. 23161478 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02739

Protein [Map View]
MGASGRWIKTLAKVATKSRFRKKHSVDLDAEKLQDSYAHSVIDTGVSTSASLQSYCGAPYEEQSKEHYAATRIQTAFRAF
LARRALRALKGLVRLQALVRGHSVRKQAAVTLRCMQALVRVQARLRARRVRLALESETRQQLQQQLADEARVREIEDGWC
DGIGSVEQIQAKLIKRQEAAAKRERAMAYALTHQWQAETRQLSAHNGFQPEEKNWERNRFLDSYLVEDAKLGENNIEQAE
NVHKTQMKSASKMQNTSDLVSGVSSQKATWPPSLSDGDSSSPGISSSMPVVSMAMSKKDDLAVEVNSRPVAGLRSRKPDR
SSRGRLSLPNSGKSLGSQSAKAKRAGTLTPTSQKVAVEDNSAQNQRRRNSEPTK*

DNA
ATGGGTGCTTCAGGGAGATGGATTAAAACATTGGCCAAGGTTGCTACCAAGAGCCGGTTTAGGAAAAAACATTCAGTTGA
TTTAGACGCTGAGAAACTTCAAGATTCATATGCGCATAGTGTAATAGATACTGGAGTCTCTACTTCAGCTTCACTACAAT
CCTACTGTGGTGCACCTTATGAAGAGCAAAGTAAGGAACATTATGCTGCAACACGCATCCAAACAGCTTTTCGAGCCTTT
CTCGCTAGAAGGGCTTTACGAGCGTTGAAGGGACTGGTTAGACTTCAAGCACTCGTTAGAGGACACTCTGTGAGGAAACA
AGCAGCTGTGACGCTTCGGTGCATGCAAGCGTTAGTAAGAGTCCAGGCTCGTTTACGCGCTAGACGTGTTCGCCTCGCCT
TGGAGAGTGAAACGCGTCAGCAACTACAGCAACAGCTAGCAGATGAAGCCCGAGTTCGAGAAATAGAGGACGGTTGGTGC
GATGGCATTGGTTCTGTTGAACAGATCCAAGCAAAGCTGATAAAGAGGCAGGAAGCTGCAGCTAAGCGTGAGAGGGCTAT
GGCATATGCTTTGACTCACCAGTGGCAAGCAGAGACTAGGCAGTTATCTGCGCACAATGGATTTCAACCTGAGGAAAAAA
ACTGGGAACGGAACCGGTTTCTTGATAGTTACCTAGTGGAAGATGCAAAATTAGGTGAAAACAACATAGAGCAGGCTGAG
AATGTGCATAAAACGCAGATGAAAAGTGCAAGCAAGATGCAAAACACTTCAGATCTTGTGTCCGGTGTTTCAAGTCAGAA
GGCAACATGGCCACCATCTCTGTCTGATGGTGATTCGTCTTCTCCTGGAATATCTTCAAGCATGCCAGTGGTGTCCATGG
CTATGTCAAAGAAAGACGATCTTGCTGTAGAAGTTAACTCAAGACCTGTAGCTGGTTTAAGATCAAGAAAGCCAGATAGA
TCTTCAAGAGGACGGTTGTCTCTGCCAAACAGTGGAAAGTCCTTAGGATCTCAGTCAGCTAAAGCCAAACGAGCAGGAAC
ACTCACGCCAACATCTCAAAAAGTAGCAGTTGAAGACAACTCTGCCCAAAACCAGAGAAGACGCAACTCTGAGCCAACAA
AATAG