Details for Chinese cabbage Locus Brara.A02738

Position : A01 ( 5`- 23154646 .. 23158971 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02738

Protein [Map View]
MTMINSLRRMARSSQVTLQSRYAASSSSGSRIFTTEASPQKQTIVGSKGHDMLAPFTAGWQSADLHPLIIAKSEGSYVYD
DHGKKYLDSLAGLWCTALGGNEPRLVSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLAMFTANKMAKAFFTNSGSEAND
TQVKLVWYYNNALGRPEKKKFIARKKSYHGSTLISASLSGLPALHQNFDLPAPFVLHTDCPHYWRFHLPGETEEEFSTRL
AKNLEDLIIKEGPETIGAFIAEPVMGAGGVIPPPATYFEKIQAVVKKYDILFIADEVICAFGRLGTMFGCDKYNIKPDLV
SLAKALSSAYMPIGAILMSQEVADVIYSQSNKLGAFSHGFTYSGHPVSCAVAIEALKIYKERNTPEHVAKVAPRFQDGLK
AFAKTSPIIGEIRGTGLILGTEFTDNKSPNELFPPEWGVGAYFGAECQKRGMLVRVAGDSIMMSPPLIISPEEIDELITI
YGEALKATEERVKELKTQQKK*

DNA
ATGACAATGATCAACAGCCTCCGACGGATGGCTCGTTCCTCTCAGGTTACTTTGCAGAGCAGGTATGCTGCTTCTTCTTC
TTCTGGTTCGAGGATCTTTACTACAGAGGCTTCACCCCAGAAGCAAACCATAGTTGGGTCTAAAGGGCATGATATGCTGG
CACCTTTTACAGCTGGGTGGCAGAGTGCTGATTTACATCCTTTGATCATTGCCAAATCTGAGGGAAGTTATGTGTATGAT
GACCATGGCAAAAAATATCTTGATTCTCTCGCTGGTCTATGGTGTACTGCCTTAGGAGGAAATGAGCCACGCCTTGTTTC
TGCTGCCGTGGAGCAGTTGAAAACCTTGCCCTTTTATCACTCCTTTTGGAACCGTACTACTAAGCCTTCTCTGGATCTTG
CTAAGGATCTTCTAGCCATGTTCACGGCTAACAAAATGGCCAAAGCTTTTTTTACAAACAGTGGATCAGAGGCCAATGAT
ACCCAGGTCAAGCTCGTCTGGTACTACAATAACGCACTTGGAAGGCCTGAGAAGAAAAAGTTTATCGCAAGAAAGAAATC
GTATCATGGCTCCACTCTAATATCAGCAAGTCTGTCCGGCCTTCCAGCACTGCACCAAAACTTTGATTTACCTGCACCGT
TTGTGCTACACACAGATTGCCCTCACTACTGGCGTTTTCATCTTCCAGGTGAGACGGAAGAGGAGTTCTCAACCAGATTA
GCCAAGAATTTAGAGGATCTCATCATTAAGGAGGGACCAGAAACAATTGGTGCTTTTATTGCTGAACCAGTCATGGGTGC
TGGTGGTGTGATACCTCCACCTGCTACTTACTTTGAGAAGATTCAAGCTGTTGTTAAGAAGTATGATATCCTGTTCATTG
CTGATGAAGTGATATGTGCATTTGGAAGGCTTGGAACAATGTTTGGCTGTGACAAATACAACATCAAGCCAGATCTTGTA
TCATTAGCTAAGGCACTTTCTTCAGCATATATGCCGATTGGAGCCATTCTTATGAGTCAAGAAGTAGCAGATGTCATTTA
TTCTCAAAGCAACAAGCTAGGTGCTTTCTCGCATGGATTTACTTATTCTGGTCATCCAGTTTCATGTGCTGTAGCGATTG
AAGCGTTAAAGATATACAAAGAGAGGAACACACCAGAGCATGTGGCCAAAGTTGCCCCAAGGTTTCAAGATGGTCTTAAA
GCTTTTGCCAAGACTAGTCCTATTATTGGAGAGATAAGAGGAACGGGTTTGATTCTTGGGACTGAGTTTACTGACAACAA
GTCACCAAACGAACTATTTCCACCAGAATGGGGTGTTGGCGCATACTTTGGAGCCGAGTGCCAGAAGCGTGGGATGTTAG
TCCGAGTCGCAGGTGATAGCATAATGATGTCTCCACCGCTCATTATCTCACCTGAAGAGATCGATGAGTTGATAACTATC
TACGGGGAAGCATTGAAAGCTACGGAAGAGAGGGTAAAAGAACTCAAGACTCAGCAAAAGAAGTGA