Details for Chinese cabbage Locus Brara.A02735

Position : A01 ( 5`- 23141013 .. 23141588 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02735

Protein [Map View]
MVKFLKQNKAVILLQGRYAGKKAVIIRSFDDGNRERPYGHCLVAGLKKYPSKVIRKDSAKKTAKKSRVKCFIKVVNYQHL
MPTRYTLDVDLKEVATLEALSSKDKKVAALKEAKAKLEERFKTGKNRWFFTKLRF*

DNA
ATGGTTAAGTTTCTTAAGCAGAACAAAGCGGTGATCCTCCTTCAAGGCCGTTACGCCGGCAAGAAGGCTGTGATCATCCG
CTCCTTCGACGACGGAAACCGCGAGCGACCTTACGGGCACTGCCTCGTCGCCGGACTCAAGAAGTACCCTAGCAAGGTCA
TCCGCAAGGACTCGGCCAAGAAGACGGCGAAGAAGTCGAGGGTCAAGTGTTTCATCAAGGTCGTGAATTACCAGCATCTG
ATGCCTACTCGTTACACGCTTGACGTGGATCTGAAGGAAGTGGCCACTCTCGAAGCTCTGTCTTCGAAGGATAAGAAGGT
GGCGGCTCTTAAGGAGGCCAAGGCTAAGCTCGAGGAGAGGTTCAAGACTGGAAAGAACAGGTGGTTCTTCACCAAGCTCA
GGTTTTGA