Details for Chinese cabbage Locus Brara.A02734

Position : A01 ( 5`- 23136853 .. 23140258 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02734

Protein [Map View]
MIQTDHNQSSVEKPPQGPYTSPPPIGYPTRDAMLSDPPPPAVETKSKGDGFWKGCCAAICCCCVLDACF*

DNA
ATGATCCAAACCGATCACAACCAATCTTCTGTGGAAAAACCTCCACAGGGGCCGTACACAAGCCCCCCGCCGATAGGCTA
TCCGACAAGGGATGCGATGTTGAGTGATCCTCCTCCGCCCGCAGTGGAGACGAAGTCCAAGGGCGATGGGTTTTGGAAAG
GATGTTGTGCTGCCATATGCTGCTGTTGTGTTCTGGACGCATGCTTCTGA