Details for Chinese cabbage Locus Brara.A02732

Position : A01 ( 5`- 23125813 .. 23128500 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02732

Protein [Map View]
MDYEHNTNPFARASGSGSASASSSSSFSSSVADTDDDQTIARMLAEDESLRREGMLGKRLSHLDSIPHTPRINTKIPDIN
DATLDHELLSVRLATYGLAELQMEGDGNCQFRALADQLFGNPDYHKHVRKHIVKQLKEQRKLYEGYVPMKYRHYTRKMKK
PGEWGDHVTLQAAADRFEAKICLLTSFREQSYIEILPHNKNPLREAWLSFWSEVHYNSLYSSGDVPTRKPRRKHWLF*

DNA
ATGGATTATGAACACAATACGAATCCATTTGCAAGGGCAAGTGGAAGTGGAAGTGCAAGTGCGAGTTCCAGCTCCAGTTT
TAGCAGCAGCGTGGCGGATACAGATGATGACCAAACCATTGCGCGTATGTTAGCTGAAGACGAGAGCTTAAGAAGAGAGG
GCATGCTTGGGAAGAGACTCTCTCATTTAGATTCTATCCCTCACACTCCTCGGATTAACACTAAAATACCAGATATAAAT
GATGCAACATTAGACCATGAGCTCCTCTCTGTGAGGTTGGCCACATATGGGTTAGCTGAACTACAGATGGAGGGGGATGG
GAATTGCCAGTTCCGAGCTCTGGCAGACCAGCTTTTTGGCAATCCAGATTACCATAAGCATGTAAGGAAGCATATTGTAA
AGCAGTTGAAAGAGCAACGAAAGTTATACGAAGGATATGTGCCGATGAAATACAGACACTACACCAGGAAGATGAAGAAA
CCGGGTGAATGGGGAGATCACGTCACTCTTCAAGCTGCTGCTGATCGTTTCGAAGCCAAGATCTGCCTACTCACATCATT
TCGGGAACAATCCTACATCGAGATTCTTCCTCATAACAAGAACCCTCTTAGAGAGGCTTGGCTTAGCTTCTGGAGCGAAG
TGCATTACAATTCTCTATACTCTAGTGGAGATGTTCCCACAAGAAAACCTAGGAGGAAGCACTGGCTCTTCTAG