Details for Chinese cabbage Locus Brara.A02729

Position : A01 ( 5`- 23098575 .. 23101318 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02729

Protein [Map View]
MIATVLRRSCLDASRRTLSSSLTSINAVLFHHFTPSAAAKVSDVKPSFALGNQFGGKSRGFHFQSGPSEFRSTMVSPAGF
AISETSDRAIADSESSGDGLAIAELGISPEIVKALSAKGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAFGIPIID
KIIKFNAKHGRGRNPLCLVLAPTRELARQVEKEFRESAPSLDTICVYGGTPIGQQMRQLDYGVDVAVGTPGRIIDLIKRG
ALNLSEVQFVVLDEADQMLQVGFAEDVEIILERLPEKRQSMMFSATMPSWIRSLTKKYLNDPLTIDLVGDSDQKLADGIT
TYSIMADSYGRASIIGPLVTEHAKGGKCIVFTQTKRDADRLSYGLARTFKCEALHGDISQSQRERTLAGFRDGHFNILVA
TDVAARGLDVPNVDLVIHYELPNNTETFVHRTGRTGRAGKKGSAILIYSQDQSRAVKIIEREVGSRFTELPSIAVERGGS
IYEGIGGRSGESFGGGMRDRGSSFGGRSGGGGYGGYGSSSGRSGNRYSGGSERSGFGSFGSDRSSGFGGFGSDRSSQSSG
RGGFGGRSDDYGSSGGRSNRSSGFGGFGSDRSSQSGGRSSFGGGFGSNDGKRSY*

DNA
ATGATCGCCACCGTACTCCGCCGATCTTGCCTCGATGCGTCAAGGCGGACTCTCTCCTCATCGCTGACCTCCATCAACGC
GGTTCTATTTCACCATTTTACTCCTTCTGCCGCCGCCAAAGTCTCCGATGTCAAGCCTAGCTTCGCTCTCGGGAATCAGT
TTGGCGGTAAATCGAGGGGATTTCATTTTCAATCTGGACCCTCGGAGTTCAGATCGACGATGGTGTCTCCTGCGGGGTTT
GCGATATCTGAGACTAGCGACAGAGCAATTGCAGATTCAGAGAGCAGTGGCGATGGGCTCGCGATAGCTGAGCTCGGGAT
ATCTCCTGAGATCGTCAAAGCTTTGAGTGCTAAGGGTATAGAGAAACTCTTCCCGATTCAGAAAGCTGTGCTTGAGCCAG
CGATGCAAGGCCGTGACATGATCGGTCGTGCTAGGACAGGAACTGGAAAGACTCTTGCTTTTGGGATTCCCATCATTGAC
AAGATCATCAAATTCAACGCCAAACATGGACGTGGGAGGAATCCTCTTTGTTTGGTTTTGGCGCCGACAAGGGAGCTTGC
TCGCCAAGTTGAGAAGGAGTTTAGGGAGTCTGCTCCAAGCTTGGATACTATTTGTGTTTATGGAGGTACTCCCATTGGAC
AGCAGATGAGGCAGCTTGACTATGGTGTTGATGTCGCTGTTGGTACTCCTGGTCGTATCATTGATCTCATTAAGCGAGGA
GCTCTCAATCTTTCCGAGGTTCAGTTTGTGGTTCTCGATGAAGCTGATCAGATGCTTCAAGTCGGGTTTGCGGAGGATGT
TGAGATTATATTGGAAAGGTTGCCTGAGAAACGTCAGAGCATGATGTTTTCCGCAACAATGCCGAGTTGGATCAGATCCC
TTACCAAGAAGTACCTCAATGATCCTTTGACAATTGATCTGGTTGGAGATTCTGATCAGAAGCTCGCAGATGGAATTACA
ACATATTCTATCATGGCAGATTCTTATGGTAGAGCTTCAATTATCGGTCCTCTTGTAACGGAGCATGCTAAAGGAGGAAA
ATGCATTGTTTTCACCCAGACAAAACGGGATGCTGATCGCCTTTCATATGGCTTGGCAAGAACCTTCAAGTGCGAAGCTT
TACACGGTGATATATCTCAGAGTCAGAGGGAAAGAACACTTGCTGGTTTCCGTGATGGGCATTTCAACATTCTTGTTGCC
ACTGATGTTGCTGCCCGTGGTCTTGATGTTCCTAATGTCGATCTGGTGATTCATTATGAGCTTCCGAATAACACTGAGAC
GTTTGTCCACAGAACGGGGAGAACAGGACGTGCCGGGAAGAAAGGAAGTGCTATTCTCATCTACAGTCAAGATCAATCCA
GGGCTGTTAAAATAATTGAGAGAGAAGTCGGGAGTCGCTTCACTGAGCTCCCTAGCATTGCTGTTGAACGTGGTGGAAGC
ATATATGAAGGAATAGGTGGTCGATCTGGTGAGTCTTTTGGAGGAGGCATGAGAGATCGCGGTTCAAGCTTTGGTGGCCG
TTCAGGTGGTGGTGGTTATGGTGGTTACGGTAGCAGCAGTGGCCGTTCAGGCAACCGTTATTCTGGTGGTTCGGAGCGCT
CTGGCTTTGGGAGCTTCGGTTCAGACCGTTCCTCTGGTTTCGGGGGCTTTGGTTCGGATCGTTCTTCTCAGTCAAGTGGA
AGGGGAGGCTTTGGTGGTCGGTCAGATGATTATGGCAGCAGTGGTGGCCGTAGCAACCGTTCTTCTGGTTTCGGGGGTTT
TGGTTCAGATCGTTCTTCTCAGTCAGGTGGAAGGAGCAGCTTTGGTGGTGGCTTTGGCTCAAACGATGGTAAAAGGTCTT
ACTGA