Details for Chinese cabbage Locus Brara.A02726

Position : A01 ( 5`- 23040118 .. 23046588 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02726

Protein [Map View]
MDRNREARRVPMAAAATGNALSRRRHRAGSFRDSPEEEGPVELPEAARLRDRGGSGKKERDRERDRERERERDRLNSRSK
RRRGERLMMVHDGGDESSEESVNDDEEYDDVKMLPPPASNNISPASFSSSLSNHHQRKNFPPPPSKTFRSPHTPAPVSEM
IGVSVPRKARSACTKRPHESWASSATGGALLASGEHSHRQVSTSPSSSTVSVHRKKMPSGTKQKPLPPKSSSPVVAVQDE
IEIEIAEVLYGMMRMPLATSKQESATNDGGAKTKTTVDVKSKVSSPISNSQTVLQSSTITLAANASSFNAIAPKKKKPRH
VKYDDENSPSLPSRAIKSEAEAPSKTQPASVDQLKRSGSAEESTSVLDSTNPQARDSTAALDSRSAEKKESNLSKEETVM
PKVESSSGVRSDGDGATTTISGAKPSSVEKEKFEIDLMAPPPVRSSSERGGEMEGVAAEAKPKATEVETEDGGNATVLES
EEKKRPKSAVGETEPHKPERSYELKLDLDKSDHVGAINKHHVQKQPQQQQQPSVPDKTAQAGTLPMHMSMPGWPGGLPTM
GYMPPTQIVPTDTSSLSSAAMQPPPHLLFNQPRPKRCATHCYIARNIQSHQQFTKMNSFWPAAAGSAPLYGTKACNLSLM
PPTELQGTVLGRSSNPVPDKNSQSTSKSSDTAQRNQILLQQALPQGATNNIMHGPTFIFPVGQQPHTAATSVRPPSGNTA
SPGATATANSMNGSASAAPAGAPTMTFSYPGMPGSETQYLAILQNNGYQFPVPAHVGASPAYRGAPGQRIPFFSGSFYPS
QMIQPSFSQPQKQQQQAGQMLQSHPPSNQNGSVSTGSSAAQKHLQNQQLRPPINPGNSQGFPTHKVQSQPLSFQQRQPRE
NATQHSETVGGDSPSTADSRGSRSSVTYGQNYGMQMQPPNLGLMSSAAPGGGVVVSSSNHGEKKSQQVSKAGVESFPSQG
YAMTFATFNGVNSTPPLNMSSVGQNHAIFHSMPEAARQGYQMMAANVAAQAAQQKMNYSAPSDDGKSGSNATANTREEQR
KTGGAAGITSGLNGAQSIAFSNKHDLADASVSAVTSGSIVDTSRLLNHGSTQPQSSSSVLTSHQQQQLQHLQHQHQQQQQ
QQHMQRSQLQQPYTTMYLQKQQRYATSVAASAARTKGPVASNGSGFADHNISVSPAGSAKLNANTGFPQNLVQSSSTQVQ
SPQWKNNSPRTSNTSQAQSPSILSPSSSAAAASSAAAASSVRNVSHKQQNRPQQSQISFASNSKPMASGSPMQQVQGGTN
NQAPSPPMLVGSPSTSSVSKSAGGSPRTAASASSAVNKAGQASSTTHSSSQPSKNLQSASAASSAGGRNNGPSVLGNPTT
SSGSKSQQQQQQLPKHGLQQQAQLFFSNPYMHSQNQHQQQQITIPPSGGYYIQRHQQQPGSSAAACPPVALSGCTTGAVT
ATSDPAKAIAAAATATAAASNMKGGGGGMGKTQQHQLVPPGFPYVHAVPPAVQVKPIDQKQQAGE*

DNA
ATGGATAGAAATAGAGAAGCTAGAAGAGTACCCATGGCGGCGGCGGCTACCGGAAACGCTTTGTCACGGCGGAGACATAG
AGCCGGAAGCTTCAGAGATTCTCCAGAGGAGGAAGGTCCGGTGGAGTTACCGGAGGCGGCGAGGCTGAGAGATCGAGGAG
GGAGTGGGAAGAAGGAACGAGATCGGGAACGTGATAGAGAGAGGGAACGGGAGAGAGATCGGTTAAACAGCCGGAGCAAA
AGGAGGAGAGGAGAACGGTTGATGATGGTTCACGACGGCGGCGACGAAAGCTCGGAAGAGAGTGTCAACGACGATGAAGA
ATATGACGACGTGAAGATGCTTCCTCCTCCGGCGAGTAATAATATCTCCCCCGCCTCGTTTTCATCGTCTCTTTCGAATC
ATCACCAGAGGAAGAACTTTCCTCCGCCACCGTCGAAAACTTTCAGATCGCCTCATACTCCGGCGCCGGTATCTGAGATG
ATCGGCGTATCGGTTCCTAGAAAAGCTCGGTCAGCTTGTACAAAGAGACCACATGAGTCATGGGCGTCTAGTGCCACCGG
CGGTGCTTTACTTGCTTCCGGAGAGCACAGCCACCGCCAAGTATCCACTTCTCCTTCTTCATCCACTGTTTCTGTCCACC
GGAAAAAGATGCCGTCAGGGACGAAACAGAAGCCACTCCCGCCCAAGTCATCATCTCCGGTGGTGGCTGTTCAAGACGAG
ATAGAGATCGAGATCGCTGAGGTGTTGTACGGGATGATGAGGATGCCTCTCGCTACGTCAAAACAAGAATCTGCCACTAA
CGACGGAGGTGCAAAAACAAAAACAACTGTAGATGTCAAGTCCAAAGTATCTTCACCCATCTCCAATTCTCAAACGGTTC
TTCAGTCTTCCACCATCACACTTGCTGCTAATGCGAGCTCGTTTAATGCCATTGCTCCTAAAAAAAAGAAGCCGAGGCAT
GTCAAGTACGACGACGAGAACAGTCCCAGCTTACCATCACGCGCCATTAAATCTGAAGCAGAAGCTCCGTCAAAGACTCA
ACCTGCTTCCGTTGATCAGCTCAAAAGATCAGGATCTGCTGAAGAAAGCACCTCAGTTTTGGATTCGACCAATCCACAGG
CTAGAGACAGCACGGCAGCGTTAGATTCAAGATCAGCTGAGAAGAAGGAAAGCAATCTGTCCAAAGAGGAAACAGTAATG
CCGAAAGTTGAATCTTCCTCGGGAGTTAGATCGGATGGTGACGGAGCTACTACTACCATTTCAGGAGCTAAACCAAGCTC
AGTGGAGAAGGAGAAGTTTGAGATAGATCTGATGGCCCCACCGCCGGTTAGATCGTCATCGGAGAGAGGCGGTGAGATGG
AAGGTGTGGCAGCAGAAGCTAAACCTAAAGCCACGGAAGTGGAAACGGAAGATGGAGGTAATGCGACGGTTCTCGAGTCT
GAAGAGAAGAAGAGACCTAAGAGTGCGGTGGGGGAAACTGAACCTCATAAGCCAGAGAGGAGTTATGAACTTAAACTCGA
CTTGGATAAATCTGATCACGTGGGTGCGATAAACAAGCATCATGTTCAGAAACAGCCACAACAACAACAACAACCTTCTG
TTCCAGATAAAACAGCTCAAGCTGGCACTTTACCTATGCATATGTCAATGCCTGGCTGGCCTGGGGGTCTTCCTACAATG
GGATACATGCCGCCAACGCAAATTGTCCCTACGGATACTAGTTCCTTATCGTCTGCGGCAATGCAGCCTCCTCCGCATTT
ACTTTTTAACCAACCGAGGCCTAAGAGATGTGCGACACACTGCTATATCGCTCGGAATATTCAATCTCACCAGCAATTCA
CAAAGATGAATTCGTTCTGGCCTGCAGCAGCAGGATCAGCTCCATTGTATGGGACCAAGGCCTGCAACCTCAGTCTTATG
CCTCCCACAGAACTTCAGGGGACTGTTTTGGGAAGAAGTTCCAATCCTGTTCCGGATAAGAACTCTCAATCTACTTCCAA
AAGCTCAGATACAGCTCAGAGAAATCAAATATTGCTCCAGCAAGCTCTGCCTCAAGGAGCAACGAATAACATCATGCATG
GTCCGACATTCATTTTCCCCGTGGGCCAACAGCCTCACACAGCTGCTACATCTGTTAGACCTCCTAGTGGTAACACAGCT
TCTCCTGGTGCGACAGCTACTGCGAACTCCATGAATGGCTCTGCTTCAGCTGCTCCAGCTGGTGCCCCAACAATGACCTT
CAGCTATCCGGGCATGCCAGGCAGTGAAACGCAGTATCTGGCCATCTTACAGAATAATGGCTATCAATTTCCAGTCCCAG
CACATGTTGGTGCATCACCTGCTTATAGAGGAGCTCCTGGCCAGCGGATACCATTTTTTAGTGGTTCGTTCTACCCCTCC
CAAATGATCCAGCCTTCATTTTCTCAGCCACAGAAGCAGCAACAGCAAGCTGGTCAAATGCTCCAGAGCCATCCTCCGAG
TAACCAAAATGGAAGTGTTTCTACTGGTTCCTCAGCAGCACAAAAGCATCTGCAGAACCAACAGCTGAGACCACCGATAA
ATCCCGGGAACTCCCAAGGATTTCCAACTCACAAAGTTCAATCTCAGCCTTTGAGTTTCCAGCAAAGGCAACCTAGAGAA
AATGCGACTCAACATAGCGAGACTGTAGGAGGAGACAGCCCATCAACCGCTGATAGCCGGGGTTCTCGTTCAAGTGTTAC
CTATGGCCAGAACTATGGTATGCAGATGCAACCACCCAATTTGGGTTTGATGAGTTCAGCAGCCCCAGGTGGTGGAGTTG
TCGTATCCTCTAGCAATCATGGCGAAAAGAAATCACAACAGGTCTCAAAGGCTGGTGTGGAATCGTTTCCGTCCCAGGGG
TATGCCATGACCTTTGCGACATTCAACGGGGTTAATAGTACTCCTCCCCTGAACATGTCATCAGTTGGTCAAAATCACGC
TATCTTCCACAGCATGCCGGAAGCAGCTAGGCAAGGTTATCAAATGATGGCAGCGAATGTTGCTGCTCAAGCAGCCCAGC
AGAAAATGAACTACAGTGCTCCTTCAGATGATGGAAAATCGGGGTCTAATGCTACTGCTAATACGAGGGAAGAACAAAGG
AAAACAGGAGGAGCAGCAGGGATAACGAGTGGTCTGAATGGTGCGCAGTCTATTGCTTTCTCTAACAAGCACGACTTAGC
TGATGCATCTGTTTCTGCTGTAACGAGTGGTAGCATCGTTGATACATCCCGTTTGCTCAACCATGGTTCTACTCAGCCAC
AGAGTTCCAGTTCCGTGCTGACGTCTCATCAGCAGCAGCAGCTGCAGCATTTGCAACACCAACATCAGCAGCAGCAGCAG
CAGCAGCATATGCAACGGAGTCAATTGCAGCAACCTTACACCACCATGTATCTCCAGAAGCAGCAACGGTATGCAACTTC
AGTCGCTGCTTCTGCTGCTAGAACCAAAGGGCCTGTGGCGAGTAACGGGAGTGGTTTCGCTGATCATAATATCTCTGTAT
CACCCGCCGGAAGCGCTAAGTTAAATGCCAATACAGGATTTCCTCAAAACCTTGTCCAGTCAAGCAGCACTCAAGTGCAA
TCTCCTCAGTGGAAAAACAATTCACCCAGGACATCCAACACTTCCCAAGCGCAGTCTCCGTCCATACTGTCGCCATCATC
GTCTGCTGCCGCGGCATCGTCTGCTGCCGCGGCATCGTCTGTAAGAAACGTATCGCATAAACAGCAAAACCGTCCCCAGC
AGTCGCAGATATCTTTTGCATCAAACTCAAAACCTATGGCGTCTGGTTCGCCAATGCAGCAGGTGCAAGGAGGCACCAAC
AACCAGGCTCCGTCTCCACCAATGTTAGTTGGGTCACCTTCAACGTCTTCCGTCTCCAAAAGCGCGGGTGGGAGCCCAAG
AACAGCTGCTTCGGCTTCATCAGCGGTGAACAAAGCTGGACAAGCTTCCTCTACTACTCACTCATCATCTCAGCCGTCCA
AGAACTTGCAGTCTGCATCCGCAGCTTCTTCCGCTGGTGGAAGGAACAACGGTCCTTCAGTTCTGGGAAACCCCACCACA
AGCTCTGGATCCAAGTCTCAACAACAACAGCAACAGTTGCCAAAGCATGGGTTGCAGCAGCAAGCCCAGCTTTTCTTCTC
TAATCCTTATATGCATTCTCAGAATCAACATCAACAGCAGCAGATCACTATACCTCCTTCTGGTGGTTATTACATTCAAA
GACATCAGCAACAACCAGGTTCATCCGCTGCCGCATGTCCTCCAGTCGCTCTATCCGGCTGTACCACAGGAGCCGTTACC
GCCACTTCAGATCCAGCGAAAGCCATCGCTGCTGCAGCAACAGCAACAGCAGCAGCCAGTAACATGAAAGGAGGAGGAGG
AGGTATGGGGAAGACGCAGCAACATCAGCTGGTACCTCCAGGGTTTCCGTATGTACACGCGGTTCCACCTGCGGTTCAGG
TAAAGCCCATAGATCAGAAGCAGCAAGCTGGTGAGTGA