Details for Chinese cabbage Locus Brara.A02725

Position : A01 ( 5`- 23011939 .. 23024052 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02725

Protein [Map View]
MIHTHIAEILCVKPKTKKTKTMEEDVKNKKTKKTMKIEGEVVVMKKNLLDFKDTMASLLDRIHELLGRRVSLHLISSLQP
DPGIRSFFYSSRLHLLHPHFRDTMNINALARHVLINSDGVLERTVFPSRYAMEMSSSIYKSWVFTDQALPKDLLKRGVAV
EDPSSDNGVKLLIEDYPFAVDGLEIWSAIKTWVTEYCSFYYKNDRTVQTDTEIQSWWTELRTEGHGDIQHESWWPSMQTR
DDLIETCTIIIWIASALHAAVNFGQYPYAGFLPNRPTVSRRFMPEPGTKEYTELEESEEVAFLKTITPQLQTLLGISIIE
ILSMHSTDEIYLGQRDSPNWTADDEPLEAFKRFGKSLEVIENNIIRRNNDKRLKNRTGPVNIPYTLLYPNTTDYTREGGL
TGKGIPNSVSI*

DNA
ATGATCCACACCCATATTGCAGAGATCTTATGCGTCAAACCCAAGACAAAGAAGACAAAGACGATGGAGGAAGATGTGAA
GAACAAGAAGACCAAGAAAACGATGAAGATAGAAGGAGAAGTGGTTGTTATGAAGAAGAACCTTCTTGATTTCAAAGACA
CCATGGCTTCTCTTCTCGATCGAATCCATGAGCTTCTTGGTCGTCGTGTTTCTCTCCACCTCATCAGTTCTCTCCAACCC
GACCCGGGTATTCGTTCATTCTTTTACTCGAGCCGTTTACATCTTCTTCATCCTCATTTCCGTGACACGATGAACATCAA
CGCATTGGCGCGACATGTCCTCATAAACTCTGATGGAGTTCTGGAGAGAACAGTGTTCCCTAGTCGTTACGCCATGGAGA
TGTCCTCTTCCATTTACAAGAGTTGGGTTTTTACTGATCAGGCTCTCCCCAAGGATCTACTTAAACGAGGAGTTGCCGTT
GAAGATCCGAGCAGCGATAACGGCGTTAAGCTTCTGATAGAGGATTATCCATTCGCAGTGGACGGTTTAGAGATTTGGTC
AGCGATCAAGACGTGGGTGACAGAGTACTGCTCGTTCTACTACAAGAACGACAGAACCGTCCAAACCGATACAGAGATCC
AATCATGGTGGACGGAGCTTCGAACCGAAGGTCACGGCGATATACAACACGAGTCATGGTGGCCGTCGATGCAAACCCGC
GACGACCTCATCGAAACCTGCACCATCATCATCTGGATCGCCTCTGCTCTTCACGCAGCAGTCAACTTCGGACAATACCC
TTACGCCGGTTTTCTCCCAAACCGGCCTACCGTCAGCCGCCGGTTCATGCCTGAACCGGGTACGAAAGAGTACACTGAGC
TGGAGGAAAGCGAGGAGGTTGCGTTCTTGAAGACCATCACGCCGCAGTTACAAACTCTGCTTGGTATCTCCATCATTGAG
ATTTTGTCTATGCATTCGACGGATGAGATTTATTTAGGGCAGAGAGATTCCCCGAACTGGACTGCGGATGATGAGCCTTT
AGAGGCGTTTAAGCGGTTTGGGAAGAGTTTGGAGGTGATAGAGAACAATATTATAAGGAGAAACAATGATAAGAGGTTGA
AGAACCGGACCGGACCGGTTAACATACCATACACTCTCTTGTACCCGAACACTACGGATTATACAAGAGAAGGTGGACTT
ACTGGTAAAGGGATTCCAAACAGTGTCTCTATCTAG