Details for Chinese cabbage Locus Brara.A02724

Position : A01 ( 5`- 23003445 .. 23006334 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02724

Protein [Map View]
MGKKDEKVETVLHLLRQQSPLTLNQEKFCNKECVERFLEGKGNNVKRAAKQLLSCLSWRQSIEIERLGAEEFATELSDGV
AYIAGHDGDVRPVIIFRFKNDYQKLRTQKQFLRLVAFTMETAISSMSRNAERRVVLLFDASFFRSSSAFANLLLPTLKII
GDNYPCRLYKAFIIDPPSFFPYIWKGVRPFVELSTLTTVISSLDYDEQLDISHVSLASSSSCPRSASLRFDASSNKSAVA
SGSASSRFAFTVSHNSLKPWYLSFTDTSPLNAAVSTAASKVSPISSRSLSFASPAARGLIDARQPACMRKSVFPSTPLQE
KTKTETYRKTPRPSFFQSPAMFFRGGKNVGGGEKSSREAFVPYLKFYRRPYDETAYRSKLRGPRGFVSVVSSHVRCRHAS
LSQR*

DNA
ATGGGAAAGAAAGATGAGAAAGTCGAAACTGTTCTTCATTTACTCAGACAACAATCTCCTCTCACTCTTAACCAAGAGAA
GTTCTGTAACAAAGAGTGCGTGGAGAGATTCTTGGAAGGGAAAGGAAACAACGTGAAAAGAGCTGCGAAGCAACTACTGT
CATGTCTTTCTTGGAGACAAAGCATTGAAATTGAGAGGTTAGGGGCTGAGGAATTCGCGACGGAGCTTTCCGACGGTGTA
GCTTACATCGCCGGCCATGACGGAGACGTCAGACCCGTTATAATTTTCCGTTTCAAAAACGATTATCAGAAATTGCGTAC
TCAGAAGCAATTTTTGCGTTTAGTGGCGTTCACGATGGAGACTGCAATATCGAGCATGTCCAGAAACGCGGAACGGCGCG
TGGTTCTTCTCTTCGATGCAAGCTTTTTCAGATCATCCTCTGCCTTTGCAAATCTGCTTTTACCAACCCTAAAAATTATA
GGAGATAATTATCCATGCCGACTTTACAAGGCCTTTATCATTGACCCTCCCTCTTTTTTCCCTTACATTTGGAAGGGCGT
ACGTCCATTCGTGGAGCTATCAACGCTCACGACGGTGATCTCTTCGCTGGACTATGACGAGCAGCTAGATATCAGCCACG
TTTCATTAGCATCCTCATCATCATGTCCTAGATCCGCTTCCCTACGTTTCGATGCATCATCGAATAAATCAGCGGTCGCG
AGTGGTTCAGCTTCTTCAAGATTCGCGTTCACCGTATCTCATAACTCCTTGAAGCCGTGGTACCTTTCCTTCACTGACAC
GTCTCCTCTTAACGCAGCCGTCTCGACCGCGGCCTCTAAAGTTTCTCCGATCAGCTCGCGGTCGCTATCTTTCGCGTCTC
CGGCGGCGCGTGGCTTAATAGACGCGAGACAACCCGCATGCATGAGAAAGAGTGTGTTTCCCTCGACGCCGTTGCAGGAG
AAGACGAAAACGGAGACGTACCGGAAAACACCACGTCCGTCTTTCTTTCAGTCTCCGGCGATGTTTTTTCGCGGGGGAAA
AAATGTTGGCGGAGGCGAGAAGTCATCACGTGAAGCGTTCGTACCATATCTGAAGTTTTACCGGAGACCGTACGATGAGA
CGGCCTATAGGTCTAAACTGCGGGGTCCACGTGGGTTTGTGTCGGTCGTGTCTTCGCACGTAAGATGTCGTCATGCGTCT
TTATCTCAACGGTAA