Details for Chinese cabbage Locus Brara.A02722

Position : A01 ( 5`- 22988543 .. 22990358 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02722

Protein [Map View]
MELSSSAQILRPKLGFTVSLPRRSSIVSSSSSRPRYLGMETQSQPRQSISCASSPSNNVSPATSNESDRIGEVKRVTKET
NVSVKINLDGTGVADSSTGIPFLDHMLDQLASHGLFDVHVRATGDVHIDDHHTNEDIALAIGTALLKALGERKGINRFGD
FTAPLDEALIHVSLDLSGRPYLGYNLEIPTQRVGNYDTQLVEHFFQSLVNTSGMTLHIRQLAGRNSHHIIEATFKAFARA
LRQATENDPRRGGTIPSSKGVLSRS*

DNA
ATGGAGCTGTCTTCCTCCGCTCAGATTCTGAGACCTAAGCTCGGCTTTACAGTTTCTCTTCCTCGGAGATCATCGATCGT
TTCTTCTTCTTCTTCGCGTCCCCGATACTTGGGGATGGAAACTCAATCTCAGCCTCGTCAATCAATCTCCTGCGCTTCTT
CACCCAGCAACAACGTTTCCCCTGCGACTTCTAACGAATCAGATAGAATTGGAGAAGTGAAGAGAGTAACAAAGGAGACG
AATGTGTCAGTGAAGATCAACTTGGACGGCACTGGAGTTGCTGATTCTTCCACTGGAATCCCTTTCCTTGACCATATGCT
CGACCAACTTGCTTCACATGGCTTGTTTGATGTGCACGTAAGAGCTACTGGTGACGTTCACATCGATGACCATCACACTA
ACGAAGATATAGCTCTTGCCATTGGAACCGCTCTTTTAAAGGCACTTGGTGAGCGTAAAGGGATTAATCGGTTTGGTGAC
TTCACAGCTCCTCTAGATGAAGCCCTTATTCATGTTTCCCTCGACTTGTCTGGTAGACCATATCTTGGTTACAACTTGGA
GATTCCCACACAGAGAGTTGGGAACTATGACACTCAGTTGGTGGAGCACTTCTTCCAGTCGCTGGTTAATACTTCCGGTA
TGACACTTCACATCCGTCAGCTTGCTGGTAGAAACTCGCATCACATAATAGAGGCGACATTTAAGGCCTTTGCCAGGGCT
CTAAGACAAGCAACGGAGAATGATCCTCGCCGTGGTGGCACCATACCAAGTTCAAAAGGAGTCTTGTCACGGTCCTGA