Details for Chinese cabbage Locus Brara.A02721

Position : A01 ( 5`- 22983424 .. 22985610 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02721

Protein [Map View]
MGSVSDPGELTELAQPSFEEFQKQTSLMTSCTLLWKELSDHFTTLEENLMKKSEALKEMIGALDSQTQSSLESLKRREAT
IERSVEIVAGKVGERARAALESLEKARDGGDDGGGGGEVDDEEGLLSTLKSLCLKMDARGFWSFVTARKKELEGLRSQIP
AALVDCVDPAMLVLEAISEVFPVDKRGSGEKMTNDFGWACVVILESLAPVMVDPVIGKTRLLVTPSVKEKAKEIAETWKA
SLEERGRVENVKTPDVHTFLQHLVTFGIVKSEDLGLYRKLVVGSAWRKQMPKLAVLVGLGDQMPDMIEELISRGQQLDAV
HFTYEVGLVDKFPPVPLLKAYLRDAKKTVAEDSSNTGRASHLVARKEQSALKAVLKCIEEYKLEEEFPPENLKKRLEQLE
KTKTEKRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSSFPFIRSPSHSPQYASPAAAYPSPPTTVYSNRSPPYPYSP
ELIPASYQASPIGYPAYNGYCNGPVPVPAPAPQVYHPHYPQQHHQHAHHQQAYY*

DNA
ATGGGGTCGGTCTCCGATCCAGGCGAGCTGACCGAGTTAGCTCAGCCGAGTTTCGAGGAGTTTCAGAAGCAGACGTCGCT
GATGACGAGCTGCACGCTTCTGTGGAAAGAGCTCTCTGATCACTTCACCACGCTTGAGGAGAACCTGATGAAGAAATCGG
AGGCGTTAAAGGAGATGATCGGAGCCCTGGATAGCCAGACTCAGAGCTCCCTCGAGTCGCTGAAGCGCAGGGAGGCTACG
ATCGAGCGGAGCGTGGAGATCGTCGCTGGGAAAGTCGGGGAGCGAGCTAGAGCTGCTCTGGAGTCGCTTGAGAAAGCGAG
AGACGGAGGAGATGACGGCGGCGGCGGCGGCGAGGTTGACGATGAGGAAGGGCTTCTCTCTACTTTGAAGTCTCTCTGTT
TGAAGATGGACGCGAGGGGGTTCTGGAGTTTCGTGACGGCGAGGAAGAAGGAGCTTGAGGGGCTCCGGTCTCAGATTCCG
GCTGCGTTGGTTGATTGTGTGGATCCGGCGATGTTGGTGCTTGAGGCGATATCTGAGGTTTTCCCGGTGGATAAGAGAGG
CTCCGGAGAGAAGATGACTAATGATTTTGGATGGGCTTGTGTGGTGATTCTGGAGAGCTTAGCACCTGTGATGGTGGATC
CAGTGATTGGGAAGACGAGGCTGCTTGTTACTCCGAGCGTTAAGGAGAAAGCTAAGGAGATTGCGGAGACGTGGAAGGCG
AGCTTGGAGGAGAGAGGAAGGGTGGAGAATGTCAAGACTCCTGATGTCCATACGTTTCTTCAGCATCTTGTGACGTTTGG
GATTGTTAAAAGTGAAGATCTTGGTCTGTACAGAAAGCTTGTCGTTGGATCCGCGTGGCGCAAACAGATGCCAAAGCTTG
CTGTTTTAGTTGGTTTGGGTGATCAAATGCCTGATATGATTGAAGAGTTGATCAGCAGAGGACAACAGCTTGATGCAGTT
CATTTTACTTATGAAGTTGGCCTTGTGGATAAGTTCCCTCCCGTTCCTCTACTCAAAGCCTATCTGAGGGATGCAAAGAA
GACAGTCGCGGAAGACTCCAGCAATACTGGCCGAGCTTCGCATCTTGTGGCGCGCAAGGAGCAGTCAGCTCTTAAGGCGG
TCTTGAAATGCATAGAAGAGTACAAACTCGAGGAAGAGTTCCCTCCGGAGAACCTCAAGAAGCGGTTGGAACAGCTAGAG
AAGACCAAAACCGAGAAGAGAAAACCAGCAGCTGTGCCGGCCAACAAGAGAACCAGAGCCAGCTACAACGGTCCAATGCC
ACCAGCAAAAGCCGGGCGTATCACAAACGCGTACGTCTCTTCCTTCCCGTTCATCAGATCACCGTCTCACTCCCCTCAGT
ACGCTTCACCTGCAGCGGCTTACCCATCACCACCTACTACTGTCTACAGCAACAGGAGCCCACCTTATCCATACTCTCCT
GAGCTTATCCCCGCCTCATACCAAGCCTCACCTATCGGTTACCCAGCTTACAACGGTTATTGCAACGGCCCTGTCCCTGT
CCCAGCTCCAGCTCCTCAGGTTTACCACCCGCACTACCCTCAGCAGCACCACCAACACGCCCACCATCAGCAAGCTTACT
ACTGA