Details for Chinese cabbage Locus Brara.A02717

Position : A01 ( 5`- 22966341 .. 22966829 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02717

Protein [Map View]
MRVHPILNNNTLIHHHHHHNPTREPGKNLRRLPHIFNRVLELPLRSEADVAVEENPDCFRFVAETDGLRGGGGEMTAYMV
EIHPGITKIVVRTNGLSLGLSLDELELDVWRFRLPETTRPELVTVACVDGALVVTVPKMVSEEDDDGGFGQGVGSGRLLL
VL*

DNA
ATGAGAGTCCATCCAATTCTTAACAACAACACATTGATCCACCACCATCATCACCACAACCCGACCCGAGAACCCGGAAA
GAATCTCCGTCGCTTGCCGCACATCTTCAACCGCGTTCTCGAGCTCCCGCTAAGGTCCGAAGCAGACGTCGCCGTGGAAG
AGAACCCCGATTGCTTCAGATTCGTGGCGGAGACGGACGGTCTTCGCGGCGGCGGAGGGGAGATGACGGCGTATATGGTG
GAGATCCATCCGGGTATTACCAAGATCGTCGTTAGGACAAATGGGTTGTCTTTGGGTTTGTCGTTGGATGAGTTGGAGCT
TGATGTCTGGCGTTTTAGGCTTCCGGAGACGACGAGGCCTGAGCTTGTTACGGTCGCTTGTGTTGATGGGGCTTTGGTTG
TTACGGTTCCTAAGATGGTTTCAGAGGAAGATGATGATGGTGGTTTTGGACAAGGTGTGGGAAGTGGGAGGCTACTTCTT
GTTTTGTAA