Details for Chinese cabbage Locus Brara.A02716

Position : A01 ( 5`- 22960177 .. 22962120 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02716

Protein [Map View]
MLKKRSRSKQALMADTNQKQSKPTPKTFPRLFTAFTSFKSFTENDAVASPTSILDTKPFSALKNPFVSDNPKTHEPETRL
KLEPTRIGLAIVQDENPVPELFSRPRSGTVLFGSQLRIRVPDPPRSSSDFGTKTKNSPVSPPPEETKKAGIGSTRIFTGY
FSTSEMELSEDYTCVTCHGPNPKTIHIFDNCIVESQPGVVFFRSSDPVNDSDCIPPDSFLSSCCNCKKNLGPRDDIFMYR
GDRAFCSSECRSLEMMSEETDN*

DNA
ATGCTAAAGAAGAGATCGAGAAGCAAGCAAGCATTAATGGCGGATACGAACCAGAAACAGAGCAAACCCACGCCCAAAAC
GTTTCCACGCCTCTTCACAGCTTTCACCAGCTTCAAAAGCTTCACTGAAAACGACGCCGTCGCGAGCCCAACCTCAATCC
TCGACACCAAACCTTTCTCTGCTTTGAAAAACCCTTTTGTATCCGATAACCCGAAAACCCACGAACCCGAGACCCGACTC
AAGCTCGAACCCACAAGAATCGGACTCGCCATTGTCCAAGATGAAAACCCGGTACCCGAATTATTCTCCCGACCAAGATC
CGGAACAGTTCTATTCGGGTCACAGCTCCGGATCCGGGTCCCGGACCCTCCACGATCCTCGTCGGATTTCGGGACCAAAA
CGAAAAATTCTCCGGTTTCTCCTCCGCCGGAAGAGACAAAGAAAGCGGGTATCGGGTCGACCCGAATCTTCACGGGCTAC
TTCTCGACCAGCGAGATGGAACTATCGGAGGACTACACGTGCGTGACGTGTCACGGGCCTAACCCGAAAACGATCCATAT
ATTCGATAACTGTATCGTTGAGAGTCAACCCGGCGTCGTTTTCTTTCGAAGCTCCGACCCGGTTAACGATTCGGATTGTA
TACCACCCGACAGCTTTCTCAGCAGCTGCTGTAACTGTAAGAAGAATCTTGGACCTCGTGATGACATTTTCATGTACAGG
GGAGATAGAGCCTTCTGTAGCAGCGAATGCAGGTCTTTGGAGATGATGTCGGAAGAAACTGACAATTAA