Details for Chinese cabbage Locus Brara.A02714

Position : A01 ( 5`- 22951549 .. 22952480 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02714

Protein [Map View]
MKMGRVLVLLTVFMAVMSSTRVSAQSSCTTALISMSPCLNYITGNTTSPSQQCCSQLGNVVRSSPDCLCQALNGGGSQLG
INVNQTQALALPRACNVQTPPVSRCSNGGGSTADSPTDSPNSSGPGNGSKTVPVGEGDGSSSDGSSIEISYRLLTFLSVA
SYIAIFLKY*

DNA
ATGAAAATGGGAAGAGTTCTAGTGTTGCTTACAGTTTTTATGGCTGTGATGTCTTCTACAAGAGTCTCTGCTCAGTCCAG
TTGCACAACCGCGTTGATCAGCATGTCTCCCTGTCTCAACTACATAACCGGAAACACTACTTCTCCTTCTCAGCAATGCT
GTAGTCAGCTAGGTAATGTAGTCAGGTCTTCTCCTGACTGTTTGTGTCAAGCCCTCAACGGTGGAGGTTCTCAGCTTGGG
ATCAACGTTAACCAAACACAGGCTCTTGCCTTGCCTCGGGCTTGTAATGTTCAAACTCCTCCTGTCAGTCGCTGTAGCAA
CGGTGGTGGTTCTACTGCTGACTCTCCTACAGATTCACCAAACTCTTCAGGACCAGGAAATGGATCAAAAACTGTGCCAG
TAGGAGAAGGAGATGGATCATCTTCAGATGGAAGCTCTATCGAGATCTCATATCGTCTTCTTACCTTCCTTTCCGTGGCT
TCCTACATCGCAATCTTCTTGAAATACTGA