Details for Chinese cabbage Locus Brara.A02710

Position : A01 ( 5`- 22944497 .. 22946478 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02710

Protein [Map View]
MAINKLTITLFLLISLAVFHCLAFRVEVQEFEPPRQEGQEGPGGGSGEGWDEEATKNPYHFGQWSFKNFFQSKDGFVKML
PKFTKRSSTLFRGIENYRFLFQEMQPNTFLVPHHLDADYVFLVVQGKGVIGFVTDTANESFQITKGDVVRVPSSVTHFFA
NTNGTVPLRLAKIAVPANVPGHFQVFFPAHSGFHQSYFTGFSKDVLTASFNIPEELLGRLIRGPQQQVGQGIIRRVSPEQ
IKELTEHEHATSPSNKHKDKKDKHKDKDRSTFGSPFNLLAQDAIYSNKFGRYHEAHPKRFSQLQDLDIAVGWVNMTQGSL
FLPQYNSETTFVTFVENGCARYEMASPYTFQGEQQQPWFGPGQEEEVEEEMSGQVHKIVSRVCKGEVFILPAGHPFAILS
QDENFVAVGFGIHASNSTRTFLAGQDNMLSNINTVATRLSFGLGSKMAEKLFTSQNYSHFAPTTPSHQFPEKPKPSFQSI
FNLAGF*

DNA
ATGGCGATCAACAAATTAACCATAACACTTTTCCTTCTCATATCCTTAGCTGTTTTCCACTGCTTGGCCTTCCGTGTGGA
GGTTCAAGAGTTCGAACCACCACGACAAGAGGGACAAGAAGGTCCCGGTGGGGGCTCCGGCGAGGGATGGGATGAAGAGG
CGACAAAGAATCCTTACCACTTCGGGCAGTGGAGTTTCAAGAATTTCTTTCAGTCAAAGGATGGTTTTGTGAAAATGTTA
CCCAAGTTCACTAAACGCTCATCGACTCTCTTCCGTGGAATAGAAAACTACCGCTTCTTGTTCCAGGAGATGCAACCTAA
CACTTTCCTTGTTCCTCACCATTTAGATGCCGATTACGTGTTTCTAGTCGTACAAGGGAAGGGAGTGATTGGTTTTGTGA
CGGATACGGCAAATGAATCCTTTCAGATAACGAAAGGTGATGTGGTGAGAGTCCCATCCAGCGTCACACACTTTTTCGCG
AACACCAACGGCACCGTTCCTCTCCGTCTCGCCAAGATCGCCGTCCCGGCCAACGTTCCTGGACACTTCCAGGTTTTCTT
CCCTGCTCATTCCGGCTTTCACCAATCATATTTCACTGGGTTTAGTAAAGATGTACTCACGGCCAGTTTCAACATACCGG
AAGAATTGCTAGGAAGATTGATTAGGGGACCACAACAACAAGTGGGACAAGGGATTATACGTAGAGTTTCCCCAGAACAG
ATCAAGGAACTTACCGAACACGAACACGCTACTTCTCCTTCAAACAAACACAAAGACAAAAAGGATAAGCACAAAGACAA
GGACAGGAGCACGTTCGGGAGCCCTTTCAATCTCCTTGCACAAGATGCAATCTACTCCAACAAATTTGGCCGTTACCACG
AGGCACATCCCAAAAGGTTTAGTCAACTCCAAGACCTTGACATCGCTGTCGGTTGGGTTAACATGACACAGGGGTCATTG
TTCCTTCCTCAATATAATTCAGAAACAACCTTTGTAACGTTTGTTGAGAATGGTTGCGCCCGCTACGAGATGGCTAGTCC
TTACACATTCCAAGGAGAGCAACAACAGCCCTGGTTTGGACCAGGACAAGAAGAGGAAGTGGAAGAGGAAATGAGTGGGC
AAGTACACAAGATTGTATCACGCGTGTGTAAAGGCGAAGTTTTTATCCTTCCGGCAGGTCATCCCTTCGCTATACTCTCA
CAGGATGAAAACTTTGTCGCGGTAGGGTTTGGTATTCATGCGTCCAACAGCACAAGAACGTTCCTTGCAGGGCAAGATAA
TATGCTGAGCAATATCAACACGGTGGCTACGAGGCTGAGCTTTGGTCTGGGAAGCAAAATGGCGGAGAAGTTGTTTACGA
GCCAAAACTATTCCCACTTTGCACCTACGACTCCTAGCCATCAGTTTCCAGAGAAACCCAAGCCATCCTTTCAATCCATC
TTCAACCTAGCCGGTTTTTGA